Rabbit anti-Human FABP6 Polyclonal Antibody | anti-FABP6 antibody

FABP6 (Intestinal Bile Acid-binding Protein, I-BABP, Intestinal 15kD Protein, I-15P, Ileal Lipid-binding Protein, ILBP, Fatty Acid-binding Protein 6, Gastrotropin, GT, ILBP, ILLBP) (FITC)

Cat. Num. AAA6377913

• Gene Names: FABP6; ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FABP6; Polyclonal Antibody; FABP6 (Intestinal Bile Acid-binding Protein; I-BABP; Intestinal 15kD Protein; I-15P; Ileal Lipid-binding Protein; ILBP; Fatty Acid-binding Protein 6; Gastrotropin; GT; ILLBP) (FITC); anti-FABP6 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human FABP6.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).

• Applicable Applications for anti-FABP6 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human FABP6, aa1-128 (NP_001436.1).
• Immunogen Sequence: MAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA
• Conjugate: FITC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FABP6 expression in transfected 293T cell line by FABP6 polyclonal antibody. Lane 1: FABP6 transfected lysate (14.4kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-FABP6 antibody

FABP6 is the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

Product Categories/Family for anti-FABP6 antibody

Antibodies; Binding Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 4557583
• NCBI GeneID: 2172
• NCBI Accession #: NP_001436.1
• NCBI GenBank Nucleotide #: NM_001445
• UniProt Accession #: P51161; Q07DR7; Q8TBI3; Q9UGI7
• Molecular Weight: 19,874 Da
• NCBI Official Full Name: gastrotropin isoform 2
• NCBI Official Synonym Full Names: fatty acid binding protein 6
• NCBI Official Symbol: FABP6
• NCBI Official Synonym Symbols: ILBP; I-15P; I-BAP; ILBP3; ILLBP; I-BABP; I-BALB
• NCBI Protein Information: gastrotropin
• UniProt Protein Name: Gastrotropin
• Protein Family: Gastrotropin
• UniProt Gene Name: FABP6
• UniProt Synonym Gene Names: ILBP; ILLBP; GT; ILBP; I-15P; I-BABP
• UniProt Entry Name: FABP6_HUMAN

NCBI Description

This gene encodes the ileal fatty acid binding protein. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. FABP6 and FABP1 (the liver fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism. Transcript variants generated by alternate transcription promoters and/or alternate splicing have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

FABP6: Ileal protein which stimulates gastric acid and pepsinogen secretion. Seems to be able to bind to bile salts and bilirubins. Isoform 2 is essential for the survival of colon cancer cells to bile acid-induced apoptosis. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. 2 isoforms of the human protein are produced by alternative promoter.

Protein type: Lipid-binding

Chromosomal Location of Human Ortholog: 5q33.3-q34

Cellular Component: cytoplasm; cytosol

Molecular Function: transporter activity; lipid binding

Biological Process: bile acid and bile salt transport; negative regulation of cell proliferation; bile acid metabolic process; lipid metabolic process; transmembrane transport