Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: FAAHSample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Rat FAAH Polyclonal Antibody | anti-FAAH antibody

FAAH Antibody - middle region

Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
FAAH; Polyclonal Antibody; FAAH Antibody - middle region; anti-FAAH antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PLGLGTDIGGSIRFPSAFCGICGLKPTGNRLSKSGLKGCVYGQTAVQLSL
Sequence Length
579
Applicable Applications for anti-FAAH antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat FAAH
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: FAAHSample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: FAAHSample Tissue: Rat Thymus lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-FAAH antibody
catalyzes the degradation and signal termination of the endocannabinoid class of signalling lipids.
Product Categories/Family for anti-FAAH antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63 kDa
NCBI Official Full Name
fatty-acid amide hydrolase 1
NCBI Official Synonym Full Names
fatty acid amide hydrolase
NCBI Official Symbol
Faah
NCBI Protein Information
fatty-acid amide hydrolase 1
UniProt Protein Name
Fatty-acid amide hydrolase 1
UniProt Gene Name
Faah
UniProt Synonym Gene Names
Faah1
UniProt Entry Name
FAAH1_RAT

NCBI Description

catalyzes the degradation and signal termination of the endocannabinoid class of signalling lipids [RGD, Feb 2006]

Uniprot Description

FAAH: Degrades bioactive fatty acid amides like oleamide, the endogenous cannabinoid, anandamide and myristic amide to their corresponding acids, thereby serving to terminate the signaling functions of these molecules. Hydrolyzes polyunsaturated substrate anandamide preferentially as compared to monounsaturated substrates. Homodimer. Highly expressed in the brain, small intestine, pancreas, skeletal muscle and testis. Also expressed in the kidney, liver, lung, placenta and prostate. Inhibited by O-aryl carbamates and alpha-keto heterocytes. Belongs to the amidase family.

Protein type: EC 3.5.1.99; Hydrolase; Membrane protein, integral

Cellular Component: Golgi membrane; endoplasmic reticulum membrane; integral to membrane

Molecular Function: protein homodimerization activity; amidase activity; carbon-nitrogen ligase activity, with glutamine as amido-N-donor; fatty acid amide hydrolase activity; phospholipid binding; acylglycerol lipase activity; hydrolase activity, acting on ester bonds; lipid binding

Biological Process: fatty acid catabolic process; fatty acid metabolic process

Research Articles on FAAH

Similar Products

Product Notes

The FAAH faah (Catalog #AAA3223619) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The FAAH Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's FAAH can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the FAAH faah for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PLGLGTDIGG SIRFPSAFCG ICGLKPTGNR LSKSGLKGCV YGQTAVQLSL. It is sometimes possible for the material contained within the vial of "FAAH, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.