Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FA2H expression in transfected 293T cell line by FA2H polyclonal antibody. Lane 1: FA2H transfected lysate (40.92kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FA2H Polyclonal Antibody | anti-FA2H antibody

FA2H (Fatty Acid 2-hydroxylase, Fatty Acid alpha-hydroxylase, FAAH)

Gene Names
FA2H; FAAH; FAH1; SCS7; SPG35; FAXDC1
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
FA2H; Polyclonal Antibody; FA2H (Fatty Acid 2-hydroxylase; Fatty Acid alpha-hydroxylase; FAAH); Anti -FA2H (Fatty Acid 2-hydroxylase; anti-FA2H antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human FA2H.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAPAPPPAASFSPSEVQRRLAAGACWVRRGARLYDLSSFVRHHPGGEQLLRARAGQDISADLDGPPHRHSANARRWLEQYYVGELRGEQQGSMENEPVALEETQKTDPAMEPRFKVVDWDKDLVDWRKPLLWQVGHLGEKYDEWVHQPVTRPIRLFHSDLIEGLSKTVWYSVPIIWVPLVLYLSWSYYRTFAQGNVRLFTSFTTEYTVAVPKSMFPGLFMLGTFLWSLIEYLIHRFLFHMKPPSDSYYLIMLHFVMHGQHHKAPFDGSRLVFPPVPASLVIGVFYLCMQLILPEAVGGTVFAGGLLGYVLYDMTHYYLHFGSPHKGSYLYSLKAHHVKHHFAHQKSGFGISTKLWDYCFHTLTPEKPHLKTQ
Applicable Applications for anti-FA2H antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human FA2H, aa1-372 (AAH17049.2).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FA2H expression in transfected 293T cell line by FA2H polyclonal antibody. Lane 1: FA2H transfected lysate (40.92kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FA2H expression in transfected 293T cell line by FA2H polyclonal antibody. Lane 1: FA2H transfected lysate (40.92kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-FA2H antibody
Required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids.
Product Categories/Family for anti-FA2H antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
42,791 Da
NCBI Official Full Name
fatty acid 2-hydroxylase
NCBI Official Synonym Full Names
fatty acid 2-hydroxylase
NCBI Official Symbol
FA2H
NCBI Official Synonym Symbols
FAAH; FAH1; SCS7; SPG35; FAXDC1
NCBI Protein Information
fatty acid 2-hydroxylase; fatty acid alpha-hydroxylase; fatty acid hydroxylase domain containing 1; spastic paraplegia 35 (autosomal recessive)
UniProt Protein Name
Fatty acid 2-hydroxylase
Protein Family
UniProt Gene Name
FA2H
UniProt Synonym Gene Names
FAAH
UniProt Entry Name
FA2H_HUMAN

NCBI Description

This gene encodes a protein that catalyzes the synthesis of 2-hydroxysphingolipids, a subset of sphingolipids that contain 2-hydroxy fatty acids. Sphingolipids play roles in many cellular processes and their structural diversity arises from modification of the hydrophobic ceramide moiety, such as by 2-hydroxylation of the N-acyl chain, and the existence of many different head groups. Mutations in this gene have been associated with leukodystrophy dysmyelinating with spastic paraparesis with or without dystonia.[provided by RefSeq, Mar 2010]

Uniprot Description

FA2H: Required for alpha-hydroxylation of free fatty acids and the formation of alpha-hydroxylated sphingolipids. Defects in FA2H are a cause of spastic paraplegia autosomal recessive type 35 (SPG35). Spastic paraplegia is a neurodegenerative disorder characterized by a slow, gradual, progressive weakness and spasticity of the lower limbs. Belongs to the sterol desaturase family. SCS7 subfamily.

Protein type: Membrane protein, multi-pass; Membrane protein, integral; Oxidoreductase; EC 1.-.-.-

Chromosomal Location of Human Ortholog: 16q23

Cellular Component: endoplasmic reticulum membrane; endoplasmic reticulum; integral to membrane

Molecular Function: iron ion binding; heme binding

Biological Process: sphingolipid metabolic process; myelin maintenance in the central nervous system; sebaceous gland cell differentiation; myelin maintenance in the peripheral nervous system; lipid modification; fatty acid metabolic process; regulation of hair cycle; fatty acid biosynthetic process; regulation of cell proliferation

Disease: Spastic Paraplegia 35, Autosomal Recessive

Research Articles on FA2H

Similar Products

Product Notes

The FA2H fa2h (Catalog #AAA6011753) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FA2H (Fatty Acid 2-hydroxylase, Fatty Acid alpha-hydroxylase, FAAH) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FA2H can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the FA2H fa2h for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAPAPPPAAS FSPSEVQRRL AAGACWVRRG ARLYDLSSFV RHHPGGEQLL RARAGQDISA DLDGPPHRHS ANARRWLEQY YVGELRGEQQ GSMENEPVAL EETQKTDPAM EPRFKVVDWD KDLVDWRKPL LWQVGHLGEK YDEWVHQPVT RPIRLFHSDL IEGLSKTVWY SVPIIWVPLV LYLSWSYYRT FAQGNVRLFT SFTTEYTVAV PKSMFPGLFM LGTFLWSLIE YLIHRFLFHM KPPSDSYYLI MLHFVMHGQH HKAPFDGSRL VFPPVPASLV IGVFYLCMQL ILPEAVGGTV FAGGLLGYVL YDMTHYYLHF GSPHKGSYLY SLKAHHVKHH FAHQKSGFGI STKLWDYCFH TLTPEKPHLK TQ. It is sometimes possible for the material contained within the vial of "FA2H, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.