Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: F2RL1Sample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit F2RL1 Polyclonal Antibody | anti-F2RL1 antibody

F2RL1 Antibody - C-terminal region

Gene Names
F2RL1; PAR2; GPR11
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
F2RL1; Polyclonal Antibody; F2RL1 Antibody - C-terminal region; anti-F2RL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SAYVLMIRMLRSSAMDENSEKKRKRAIKLIVTVLAMYLICFTPSNLLLVV
Sequence Length
397
Applicable Applications for anti-F2RL1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 85%; Human: 100%; Mouse: 86%; Pig: 86%; Rabbit: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human F2RL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: F2RL1Sample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: F2RL1Sample Type: Hela Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-F2RL1 antibody
This is a rabbit polyclonal antibody against F2RL1. It was validated on Western Blot

Target Description: Coagulation factor II (thrombin) receptor-like 1 (F2RL1) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. The predicted protein sequence is 83% identical to the mouse receptor sequence.
Product Categories/Family for anti-F2RL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
proteinase-activated receptor 2 preproprotein
NCBI Official Synonym Full Names
F2R like trypsin receptor 1
NCBI Official Symbol
F2RL1
NCBI Official Synonym Symbols
PAR2; GPR11
NCBI Protein Information
proteinase-activated receptor 2
UniProt Protein Name
Proteinase-activated receptor 2
UniProt Gene Name
F2RL1
UniProt Synonym Gene Names
GPR11; PAR2; PAR-2
UniProt Entry Name
PAR2_HUMAN

NCBI Description

This gene encodes a member of the G-protein coupled receptor 1 family of proteins. The encoded cell surface receptor is activated through proteolytic cleavage of its extracellular amino terminus, resulting in a new amino terminus that acts as a tethered ligand that binds to an extracellular loop domain. Activation of the receptor has been shown to stimulate vascular smooth muscle relaxation, dilate blood vessels, increase blood flow, and lower blood pressure. This protein is also important in the inflammatory response, as well as innate and adaptive immunity. [provided by RefSeq, Jun 2016]

Uniprot Description

F2RL1: a G-protein coupled receptor for trypsin and trypsin-like enzymes. Acts as a sensor for proteolytic enzymes generated during infection. Modulates pro-inflammatory responses, and innate and adaptive immunity. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. Activates several signaling molecules including phospholipase C (PLC), mitogen-activated protein kinase (MAPK), IKK/NFkB and Rho. Elevates intracellular calcium. Can also be transactivated by cleaved PAR1. Can signal synergistically with TLR4 and probably TLR2 in inflammatory responses and modulates TLR3 signaling. Has a protective role in establishing the endothelial barrier; the activity involves coagulation factor X. Proposed to have a bronchoprotective role in airway epithelium, but also shown to compromise the airway epithelial barrier by interrupting E-cadherin adhesion. Involved in the regulation of vascular tone; activation results in hypotension presumably mediated by vasodilation. Associates with a subset of G proteins alpha subunits such as G alpha-q, G alpha-11, G alpha-14, G alpha- 12 and G alpha-13, but probably not with G(o) alpha, G(i) subunit alpha-1 and G(i) subunit alpha-2. However, may signal through G(i) subunit alpha. Believed to be a class B receptor that internalizes as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptor, for extended periods of time. Mediates inhibition of TNF-alpha stimulated JNK phosphorylation via coupling to G alpha-q/11; the function involves dissociation of RIPK1 and TRADD from TNFR1. Involved in cellular migration. Involved in cytoskeletal rearrangement and chemotaxis through beta-arrestin-promoted scaffolds; the function is independent of G alpha-q/11 and involves promotion of cofilin dephosphoryltaion and actin filament severing. Induces redistribution of COPS5 from the plasma membrane to the cytosol and activation of the JNK cascade is mediated by COPS5. Involved in the recruitment of leukocytes to the sites of inflammation and is the major PAR receptor capable of modulating eosinophil function such as proinflammatory cytokine secretion, superoxide production and degranulation. During inflammation promotes dendritic cell maturation, trafficking to the lymph nodes and subsequent T-cell activation. Involved in antimicrobial response of innate immune cells; activation enhances phagocytosis of Gram- positive and killing of Gram-negative bacteria. Acts synergistically with interferon-gamma in enhancing antiviral responses. Implicated in a number of acute and chronic inflammatory diseases such as of the joints, lungs, brain, gastrointestinal tract, periodontium, skin, and vascular systems, and in autoimmune disorders. Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: Golgi apparatus; integral to plasma membrane; early endosome; plasma membrane; pseudopodium

Molecular Function: G-protein coupled receptor activity; protein binding; G-protein alpha-subunit binding; G-protein beta-subunit binding; receptor activity; thrombin receptor activity; receptor binding

Biological Process: negative regulation of JNK cascade; positive regulation of positive chemotaxis; positive regulation of cytokine secretion during immune response; positive regulation of JNK cascade; positive regulation of leukocyte chemotaxis; positive regulation of vasodilation; regulation of JNK cascade; negative regulation of toll-like receptor 3 signaling pathway; T cell activation during immune response; elevation of cytosolic calcium ion concentration; positive regulation of glomerular filtration; positive regulation of superoxide release; interleukin-1 beta secretion; inflammatory response; regulation of I-kappaB kinase/NF-kappaB cascade; defense response to virus; positive regulation of toll-like receptor 3 signaling pathway; positive regulation of I-kappaB kinase/NF-kappaB cascade; neutrophil activation; positive regulation of actin filament depolymerization; positive regulation of eosinophil degranulation; positive regulation of chemotaxis; positive regulation of toll-like receptor 4 signaling pathway; positive regulation of Rho protein signal transduction; positive regulation of toll-like receptor 2 signaling pathway; positive regulation of phosphoinositide 3-kinase cascade; G-protein coupled receptor protein signaling pathway; positive regulation of pseudopodium formation; regulation of blood coagulation; innate immune response; positive regulation of transcription from RNA polymerase II promoter; blood coagulation; positive regulation of phagocytosis, engulfment; leukocyte migration; positive regulation of cell migration

Research Articles on F2RL1

Similar Products

Product Notes

The F2RL1 f2rl1 (Catalog #AAA3214631) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The F2RL1 Antibody - C-terminal region reacts with Cow, Dog, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's F2RL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the F2RL1 f2rl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SAYVLMIRML RSSAMDENSE KKRKRAIKLI VTVLAMYLIC FTPSNLLLVV. It is sometimes possible for the material contained within the vial of "F2RL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.