Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- PAR2 Picoband antibody, MBS177710, Western blottingAll lanes: Anti PAR2 (MBS177710) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 44KDObserved bind size: 49KD)

anti-Human PAR2 Polyclonal Antibody | anti-PAR2 antibody

Anti-PAR2 Antibody

Gene Names
F2RL1; PAR2; GPR11
Reactivity
Human
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
PAR2; Polyclonal Antibody; Anti-PAR2 Antibody; Proteinase-activated receptor 2; Coagulation factor II receptor like 1; Coagulation factor II receptor-like 1; Coagulation factor II thrombin receptor like 1; F2RL1; G protein coupled receptor 11; G-protein coupled receptor 11; GPR11; PAR 2; PAR-2; PAR2_HUMAN; Protease activated receptor 2; Proteinase activated receptor 2; Thrombin receptor like 1; Thrombin receptor-like 1; coagulation factor II (thrombin) receptor-like 1; anti-PAR2 antibody
Ordering
For Research Use Only!
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
397
Applicable Applications for anti-PAR2 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human PAR2 (349-383aa HDFRDHAKNALLCRSVRTVKQMQVSLTSKKHSRKS), different from the related mouse sequence by eight amino acids, and from the related rat sequence by seven amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- PAR2 Picoband antibody, MBS177710, Western blottingAll lanes: Anti PAR2 (MBS177710) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 44KDObserved bind size: 49KD)

Western Blot (WB) (Anti- PAR2 Picoband antibody, MBS177710, Western blottingAll lanes: Anti PAR2 (MBS177710) at 0.5ug/mlLane 1: HELA Whole Cell Lysate at 40ugLane 2: COLO320 Whole Cell Lysate at 40ugLane 3: SW620 Whole Cell Lysate at 40ugLane 4: HEPG2 Whole Cell Lysate at 40ugPredicted bind size: 44KDObserved bind size: 49KD)
Related Product Information for anti-PAR2 antibody
Description: Rabbit IgG polyclonal antibody for Proteinase-activated receptor 2(F2RL1) detection. Tested with WB in Human.

Background: Protease activated receptor 2 (PAR2), also known as coagulation factor II (thrombin) receptor-like 1(F2RL1) or G-protein coupled receptor 11 (GPR11), is a protein that in humans is encoded by the F2RL1 gene. F2RL1 is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. Additionally, PAR2 modulates inflammatory responses and acts as a sensor for proteolytic enzymes generated during infection.
References
1. Kawabata A (2004). "PAR-2: structure, function and relevance to human diseases of the gastric mucosa". Expert Reviews in Molecular Medicine 4(16): 1-17. 2. Lee SE, Jeong SK, Lee SH (November 2010). "Protease and protease-activated receptor-2 signaling in the pathogenesis of atopic dermatitis". Yonsei Med. J. 51 (6): 808-22. 

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,126 Da
NCBI Official Full Name
proteinase-activated receptor 2
NCBI Official Synonym Full Names
F2R like trypsin receptor 1
NCBI Official Symbol
F2RL1
NCBI Official Synonym Symbols
PAR2; GPR11
NCBI Protein Information
proteinase-activated receptor 2
UniProt Protein Name
Proteinase-activated receptor 2
Protein Family
UniProt Gene Name
F2RL1
UniProt Synonym Gene Names
GPR11; PAR2; PAR-2
UniProt Entry Name
PAR2_HUMAN

NCBI Description

Coagulation factor II (thrombin) receptor-like 1 (F2RL1) is a member of the large family of 7-transmembrane-region receptors that couple to guanosine-nucleotide-binding proteins. F2RL1 is also a member of the protease-activated receptor family. It is activated by trypsin, but not by thrombin. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. The F2RL1 gene contains two exons and is widely expressed in human tissues. The predicted protein sequence is 83% identical to the mouse receptor sequence. [provided by RefSeq, Jul 2008]

Uniprot Description

F2RL1: a G-protein coupled receptor for trypsin and trypsin-like enzymes. Acts as a sensor for proteolytic enzymes generated during infection. Modulates pro-inflammatory responses, and innate and adaptive immunity. It is activated by proteolytic cleavage of its extracellular amino terminus. The new amino terminus functions as a tethered ligand and activates the receptor. Activates several signaling molecules including phospholipase C (PLC), mitogen-activated protein kinase (MAPK), IKK/NFkB and Rho. Elevates intracellular calcium. Can also be transactivated by cleaved PAR1. Can signal synergistically with TLR4 and probably TLR2 in inflammatory responses and modulates TLR3 signaling. Has a protective role in establishing the endothelial barrier; the activity involves coagulation factor X. Proposed to have a bronchoprotective role in airway epithelium, but also shown to compromise the airway epithelial barrier by interrupting E-cadherin adhesion. Involved in the regulation of vascular tone; activation results in hypotension presumably mediated by vasodilation. Associates with a subset of G proteins alpha subunits such as G alpha-q, G alpha-11, G alpha-14, G alpha- 12 and G alpha-13, but probably not with G(o) alpha, G(i) subunit alpha-1 and G(i) subunit alpha-2. However, may signal through G(i) subunit alpha. Believed to be a class B receptor that internalizes as a complex with arrestin and traffic with it to endosomal vesicles, presumably as desensitized receptor, for extended periods of time. Mediates inhibition of TNF-alpha stimulated JNK phosphorylation via coupling to G alpha-q/11; the function involves dissociation of RIPK1 and TRADD from TNFR1. Involved in cellular migration. Involved in cytoskeletal rearrangement and chemotaxis through beta-arrestin-promoted scaffolds; the function is independent of G alpha-q/11 and involves promotion of cofilin dephosphoryltaion and actin filament severing. Induces redistribution of COPS5 from the plasma membrane to the cytosol and activation of the JNK cascade is mediated by COPS5. Involved in the recruitment of leukocytes to the sites of inflammation and is the major PAR receptor capable of modulating eosinophil function such as proinflammatory cytokine secretion, superoxide production and degranulation. During inflammation promotes dendritic cell maturation, trafficking to the lymph nodes and subsequent T-cell activation. Involved in antimicrobial response of innate immune cells; activation enhances phagocytosis of Gram- positive and killing of Gram-negative bacteria. Acts synergistically with interferon-gamma in enhancing antiviral responses. Implicated in a number of acute and chronic inflammatory diseases such as of the joints, lungs, brain, gastrointestinal tract, periodontium, skin, and vascular systems, and in autoimmune disorders. Widely expressed in tissues with especially high levels in pancreas, liver, kidney, small intestine, and colon. Moderate expression is detected in many organs, but none in brain or skeletal muscle. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, integral; Receptor, GPCR; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5q13

Cellular Component: early endosome; Golgi apparatus; integral to plasma membrane; plasma membrane; pseudopodium

Molecular Function: G-protein alpha-subunit binding; G-protein beta-subunit binding; G-protein coupled receptor activity; protein binding; receptor activity; receptor binding; thrombin receptor activity

Biological Process: blood coagulation; defense response to virus; elevation of cytosolic calcium ion concentration; G-protein coupled receptor protein signaling pathway; inflammatory response; innate immune response; interleukin-1 beta secretion; leukocyte migration; negative regulation of JNK cascade; negative regulation of toll-like receptor 3 signaling pathway; neutrophil activation; positive regulation of actin filament depolymerization; positive regulation of cell migration; positive regulation of chemotaxis; positive regulation of cytokine secretion during immune response; positive regulation of eosinophil degranulation; positive regulation of glomerular filtration; positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of JNK cascade; positive regulation of leukocyte chemotaxis; positive regulation of phagocytosis, engulfment; positive regulation of phosphoinositide 3-kinase cascade; positive regulation of positive chemotaxis; positive regulation of pseudopodium formation; positive regulation of Rho protein signal transduction; positive regulation of superoxide release; positive regulation of toll-like receptor 2 signaling pathway; positive regulation of toll-like receptor 3 signaling pathway; positive regulation of toll-like receptor 4 signaling pathway; positive regulation of transcription from RNA polymerase II promoter; positive regulation of vasodilation; regulation of blood coagulation; regulation of I-kappaB kinase/NF-kappaB cascade; regulation of JNK cascade; T cell activation during immune response

Research Articles on PAR2

Similar Products

Product Notes

The PAR2 f2rl1 (Catalog #AAA177710) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-PAR2 Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PAR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the PAR2 f2rl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PAR2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.