Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-ERVWE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Rabbit ERVWE1 Polyclonal Antibody | anti-ERVW-1 antibody

ERVWE1 antibody - N-terminal region

Gene Names
ERVW-1; ENV; ENVW; HERVW; ERVWE1; HERV7Q; HERV-7q; HERVWENV; HERV-W-ENV
Reactivity
Human, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ERVWE1; Polyclonal Antibody; ERVWE1 antibody - N-terminal region; anti-ERVW-1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TQTGMSDGGGVQDQAREKHVKEVISQLTRVHGTSSPYKGLDLSKLHETLR
Sequence Length
538
Applicable Applications for anti-ERVW-1 antibody
Western Blot (WB)
Homology
Human: 100%; Rabbit: 91%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ERVWE1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ERVWE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)

Western Blot (WB) (WB Suggested Anti-ERVWE1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: MCF7 cell lysate)
Related Product Information for anti-ERVW-1 antibody
This is a rabbit polyclonal antibody against ERVWE1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: ERVWE1 or syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene.Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The product of this gene, syncytin, is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Product Categories/Family for anti-ERVW-1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
24kDa
NCBI Official Full Name
syncytin-1
NCBI Official Synonym Full Names
endogenous retrovirus group W member 1, envelope
NCBI Official Symbol
ERVW-1
NCBI Official Synonym Symbols
ENV; ENVW; HERVW; ERVWE1; HERV7Q; HERV-7q; HERVWENV; HERV-W-ENV
NCBI Protein Information
syncytin-1
UniProt Protein Name
Syncytin-1
Protein Family
UniProt Gene Name
ERVW-1
UniProt Synonym Gene Names
ERVWE1; SU; TM
UniProt Entry Name
SYCY1_HUMAN

NCBI Description

Many different human endogenous retrovirus (HERV) families are expressed in normal placental tissue at high levels, suggesting that HERVs are functionally important in reproduction. This gene is part of an HERV provirus on chromosome 7 that has inactivating mutations in the gag and pol genes. This gene is the envelope glycoprotein gene which appears to have been selectively preserved. The gene's protein product is expressed in the placental syncytiotrophoblast and is involved in fusion of the cytotrophoblast cells to form the syncytial layer of the placenta. The protein has the characteristics of a typical retroviral envelope protein, including a furin cleavage site that separates the surface (SU) and transmembrane (TM) proteins which form a heterodimer. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Mar 2010]

Uniprot Description

ERVWE1: Retroviral envelope proteins mediate receptor recognition and membrane fusion during early infection. Endogenous envelope proteins may have kept, lost or modified their original function during evolution. This endogenous envelope protein has retained its original fusogenic properties and participates in trophoblast fusion during placenta morphogenesis. Belongs to the gamma type-C retroviral envelope protein family. HERV class-I W env subfamily.

Protein type: Membrane protein, integral; Cell surface

Chromosomal Location of Human Ortholog: 7q21.2

Cellular Component: integral to membrane; plasma membrane; viral envelope

Biological Process: anatomical structure morphogenesis; syncytium formation

Research Articles on ERVW-1

Similar Products

Product Notes

The ERVW-1 ervw-1 (Catalog #AAA3208416) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ERVWE1 antibody - N-terminal region reacts with Human, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's ERVWE1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ERVW-1 ervw-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TQTGMSDGGG VQDQAREKHV KEVISQLTRV HGTSSPYKGL DLSKLHETLR. It is sometimes possible for the material contained within the vial of "ERVWE1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.