Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot analysis of EPHX2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and HEPG2 whole cell lysates (lane 3). EPHX2 at 62KD was detected using rabbit anti- EPHX2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Rabbit EPHX2 Polyclonal Antibody | anti-EPHX2 antibody

Anti-EPHX2 Antibody

Gene Names
EPHX2; CEH; SEH
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Immunogen affinity purified.
Synonyms
EPHX2; Polyclonal Antibody; Anti-EPHX2 Antibody; CEH; SEH; P34913; Bifunctional epoxide hydrolase 2; epoxide hydrolase 2; anti-EPHX2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Isotype
IgG
Specificity
No cross reactivity with other proteins.
Purity/Purification
Immunogen affinity purified.
Form/Format
Lyophilized
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
502
Applicable Applications for anti-EPHX2 antibody
Western Blot (WB)
Application Notes
Western Blot: 0.1-0.5ug/ml
Optimal dilutions shoudl be determined by end users.
Notes
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human EPHX2 (505-543aa QHMEDWIPHLKRGHIEDCGHWTQMDKPTEVNQILIKWLD), different from the related mouse sequence by seven amino acids, and from the related rat sequence by eight amino acids.
Preparation and Storage
Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Western blot analysis of EPHX2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and HEPG2 whole cell lysates (lane 3). EPHX2 at 62KD was detected using rabbit anti- EPHX2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )

Western Blot (WB) (Western blot analysis of EPHX2 expression in rat lung extract (lane 1), mouse lung extract (lane 2) and HEPG2 whole cell lysates (lane 3). EPHX2 at 62KD was detected using rabbit anti- EPHX2 Antigen Affinity purified polyclonal antibody at 0.5ug/mL. The blot was developed using chemiluminescence (ECL) method. )
Related Product Information for anti-EPHX2 antibody
Rabbit IgG polyclonal antibody for Bifunctional epoxide hydrolase 2(EPHX2) detection.
Background: Soluble epoxide hydrolase (sEH) is a bifunctional enzyme that in humans is encoded by the EPHX2 gene. It is mapped to 8p21.2-p21.1. This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described.
References
1. "Entrez Gene: Epoxide hydrolase 2, cytoplasmic".
2. Morisseau C, Hammock BD (2013). "Impact of soluble epoxide hydrolase and epoxyeicosanoids on human health".Annu. Rev. Pharmacol. Toxicol. 53: 37-58.
3. Lee CR, North KE, Bray MS, Fornage M, Seubert JM, Newman JW, Hammock BD, Couper DJ, Heiss G, Zeldin DC (May 2006). "Genetic variation in soluble epoxide hydrolase (EPHX2) and risk of coronary heart disease: The Atherosclerosis Risk in Communities (ARIC) study". Hum. Mol. Genet.15 (10): 1640-9.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,626 Da
NCBI Official Full Name
bifunctional epoxide hydrolase 2 isoform b
NCBI Official Synonym Full Names
epoxide hydrolase 2
NCBI Official Symbol
EPHX2
NCBI Official Synonym Symbols
CEH; SEH
NCBI Protein Information
bifunctional epoxide hydrolase 2
UniProt Protein Name
Bifunctional epoxide hydrolase 2
UniProt Gene Name
EPHX2
UniProt Synonym Gene Names
CEH; SEH

NCBI Description

This gene encodes a member of the epoxide hydrolase family. The protein, found in both the cytosol and peroxisomes, binds to specific epoxides and converts them to the corresponding dihydrodiols. Mutations in this gene have been associated with familial hypercholesterolemia. Alternatively spliced transcript variants have been described. [provided by RefSeq, Feb 2012]

Uniprot Description

EPHX2: Bifunctional enzyme. The C-terminal domain has epoxide hydrolase activity and acts on epoxides (alkene oxides, oxiranes) and arene oxides. Plays a role in xenobiotic metabolism by degrading potentially toxic epoxides. Also determines steady-state levels of physiological mediators. The N-terminal domain has lipid phosphatase activity, with the highest activity towards threo- 9,10-phosphonooxy-hydroxy-octadecanoic acid, followed by erythro- 9,10-phosphonooxy-hydroxy-octadecanoic acid, 12-phosphonooxy- octadec-9Z-enoic acid, 12-phosphonooxy-octadec-9E-enoic acid, and p-nitrophenyl phospate. Belongs to the AB hydrolase superfamily. Epoxide hydrolase family.

Protein type: EC 3.1.3.76; EC 3.3.2.10; Hydrolase; Lipid Metabolism - arachidonic acid

Chromosomal Location of Human Ortholog: 8p21.2-p21.1

Cellular Component: cytoplasm; cytosol; peroxisome

Molecular Function: epoxide hydrolase activity; lipid phosphatase activity; magnesium ion binding; phosphoric monoester hydrolase activity; protein homodimerization activity; receptor binding; toxin binding

Biological Process: cholesterol homeostasis; dephosphorylation; epoxygenase P450 pathway; phospholipid dephosphorylation; stilbene catabolic process

Disease: Hypercholesterolemia, Familial

Research Articles on EPHX2

Similar Products

Product Notes

The EPHX2 ephx2 (Catalog #AAA178659) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Anti-EPHX2 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EPHX2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot: 0.1-0.5ug/ml Optimal dilutions shoudl be determined by end users. Researchers should empirically determine the suitability of the EPHX2 ephx2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPHX2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.