Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EPCAM rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in human pancreas.)

Rabbit anti-Human EPCAM Polyclonal Antibody | anti-EPCAM antibody

EPCAM (Epithelial Cell Adhesion Molecule, Ep-CAM, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, Epithelial Cell Surface Antigen, Epithelial Glycoprotein, EGP, Epithelial Glycoprotein 314, EGP314, hEGP314, KS 1/4 Antigen, KSA, Major

Gene Names
EPCAM; ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EPCAM; Polyclonal Antibody; EPCAM (Epithelial Cell Adhesion Molecule; Ep-CAM; Adenocarcinoma-associated Antigen; Cell Surface Glycoprotein Trop-1; Epithelial Cell Surface Antigen; Epithelial Glycoprotein; EGP; Epithelial Glycoprotein 314; EGP314; hEGP314; KS 1/4 Antigen; KSA; Major; anti-EPCAM antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Full length human EPCAM, aa1-314 (NP_002345.1).
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-EPCAM antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EPCAM, aa1-314 (NP_002345.1).
Immunogen Sequence
MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNA
Conjugate
PE
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(EPCAM rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in human pancreas.)

Western Blot (WB) (EPCAM rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in human pancreas.)

Western Blot (WB)

(EPCAM rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in A-431.)

Western Blot (WB) (EPCAM rabbit polyclonal antibody. Western Blot analysis of EPCAM expression in A-431.)

Western Blot (WB)

(Western Blot analysis of EPCAM expression in transfected 293T cell line by EPCAM polyclonal antibody. Lane 1: TACSTD1 transfected lysate (34.9kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EPCAM expression in transfected 293T cell line by EPCAM polyclonal antibody. Lane 1: TACSTD1 transfected lysate (34.9kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EPCAM antibody
CD326 is known as Ep-CAM, tumor associated calcium signal transducer 1, epithelial cell surface antigen, epithelial glycoprotein 2, EGP2, adenocarcinoma associated antigen, and TROP1. CD326 is a type I transmembrane protein containing six disulfide bridges and one THYRO domain. This cell surface glycosylated 40kD protein is highly expressed in the bone marrow, colon, lung, and most normal epithelial cells and is expressed on carcinomas of gastrointestinal origin. Recently, it has been reported that CD326 expression occurs during the early steps of erythrogenesis. CD326 functions as a homotypic calcium-independent cell adhesion molecule and is believed to be involved in carcinogenesis by its ability to induce genes involved in cellular metabolism and proliferation. The CD326 antigen is an immunotherapeutic target for the treatment of human carcinomas.
Product Categories/Family for anti-EPCAM antibody
References
1. Detection of Circulating Cancer Cells Using Electrocatalytic Gold Nanoparticles. Maltez-da Costa M, de la Escosura-Muniz A, Nogues C, Barrios L, Ibanez E, Merkoci A.Small. 2012 Aug 15. doi: 10.1002/smll.201201205.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
28.2kDa (248aa) 28-40kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
tumor-associated calcium signal transducer 1
NCBI Official Synonym Full Names
epithelial cell adhesion molecule
NCBI Official Symbol
EPCAM
NCBI Official Synonym Symbols
ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; EGP314; HNPCC8; TACSTD1
NCBI Protein Information
epithelial cell adhesion molecule

NCBI Description

This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. [provided by RefSeq, Dec 2008]

Research Articles on EPCAM

Similar Products

Product Notes

The EPCAM (Catalog #AAA6377480) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EPCAM (Epithelial Cell Adhesion Molecule, Ep-CAM, Adenocarcinoma-associated Antigen, Cell Surface Glycoprotein Trop-1, Epithelial Cell Surface Antigen, Epithelial Glycoprotein, EGP, Epithelial Glycoprotein 314, EGP314, hEGP314, KS 1/4 Antigen, KSA, Major reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EPCAM can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EPCAM for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EPCAM, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.