Immunohistochemistry (IHC)
(Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:200 using anti-Eomes antibody )
Rabbit Eomes Polyclonal Antibody | anti-EOMES antibody
Eomes antibody - C-terminal region
Gene Names
Eomes; Tbr2; TBR-2; C77258
Reactivity
Cow, Dog, Guinea Pig, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
Eomes; Polyclonal Antibody; Eomes antibody - C-terminal region; anti-EOMES antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY
Sequence Length
707
Applicable Applications for anti-EOMES antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 80%; Dog: 80%; Guinea Pig: 80%; Mouse: 100%; Rat: 87%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human Eomes
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:200 using anti-Eomes antibody )
Immunohistochemistry (IHC)
(Immunohistochemistry with Placenta tissue at an antibody concentration of Dilution: 1:200 using anti-Eomes antibody )
Western Blot (WB)
(WB Suggested Anti-Eomes Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Muscle)
Western Blot (WB)
(WB Suggested Anti-Eomes Antibody Titration: 0.2-1 ug/mlPositive Control: Mouse Muscle)
Related Product Information for anti-EOMES antibody
This is a rabbit polyclonal antibody against Eomes. It was validated on Western Blot
Target Description: Eomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.
Target Description: Eomes functions as a transcriptional activator playing a crucial role during development. Eomes functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification.Eomes plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Eomes also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes.
Product Categories/Family for anti-EOMES antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75kDa
NCBI Official Full Name
eomesodermin homolog isoform 1
NCBI Official Synonym Full Names
eomesodermin
NCBI Official Symbol
Eomes
NCBI Official Synonym Symbols
Tbr2; TBR-2; C77258
NCBI Protein Information
eomesodermin homolog
UniProt Protein Name
Eomesodermin homolog
Protein Family
UniProt Gene Name
Eomes
UniProt Synonym Gene Names
Tbr2; T-brain-2; TBR-2
UniProt Entry Name
EOMES_MOUSE
Research Articles on EOMES
Similar Products
Product Notes
The EOMES eomes (Catalog #AAA3203428) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Eomes antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Eomes can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the EOMES eomes for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SSDSGVYNSA CKRKRLSPST PSNGNSPPIK CEDINTEEYS KDTSKGMGAY. It is sometimes possible for the material contained within the vial of "Eomes, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
