Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EOMES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)

Rabbit EOMES Polyclonal Antibody | anti-EOMES antibody

EOMES antibody - middle region

Gene Names
EOMES; TBR2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EOMES; Polyclonal Antibody; EOMES antibody - middle region; anti-EOMES antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YTSACKRRRLSPSNSSNENSPSIKCEDINAEEYSKDTSKGMGGYYAFYTT
Sequence Length
686
Applicable Applications for anti-EOMES antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 93%; Pig: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EOMES
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EOMES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)

Western Blot (WB) (WB Suggested Anti-EOMES Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: NCI-H226 cell lysate)
Related Product Information for anti-EOMES antibody
This is a rabbit polyclonal antibody against EOMES. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: EOMES is a member of a conserved protein family that shares a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. A similiar gene disrupted in mice is shown to be essential

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
eomesodermin homolog isoform 2
NCBI Official Synonym Full Names
eomesodermin
NCBI Official Symbol
EOMES
NCBI Official Synonym Symbols
TBR2
NCBI Protein Information
eomesodermin homolog
UniProt Protein Name
Eomesodermin homolog
Protein Family
UniProt Gene Name
EOMES
UniProt Synonym Gene Names
TBR2; T-brain-2; TBR-2
UniProt Entry Name
EOMES_HUMAN

NCBI Description

This gene belongs to the TBR1 (T-box brain protein 1) sub-family of T-box genes that share the common DNA-binding T-box domain. The encoded protein is a transcription factor which is crucial for embryonic development of mesoderm and the central nervous system in vertebrates. The protein may also be necessary for the differentiation of effector CD8+ T cells which are involved in defense against viral infections. A similar gene disrupted in mice is shown to be essential during trophoblast development and gastrulation. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2013]

Uniprot Description

EOMES: Functions as a transcriptional activator playing a crucial role during development. Functions in trophoblast differentiation and later in gastrulation, regulating both mesoderm delamination and endoderm specification. Plays a role in brain development being required for the specification and the proliferation of the intermediate progenitor cells and their progeny in the cerebral cortex. Also involved in the differentiation of CD8+ T-cells during immune response regulating the expression of lytic effector genes. Up-regulated in CD8+ T-cells simultaneously stimulated with TGFB1 and IL4/interleukin-4. Expressed in CD8+ T-cells. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 3p24.1

Cellular Component: nucleus

Molecular Function: DNA binding; sequence-specific DNA binding; chromatin binding; transcription factor activity

Biological Process: CD8-positive, alpha-beta T cell differentiation during immune response; transcription, DNA-dependent; regulation of neuron differentiation; positive regulation of transcription, DNA-dependent; endodermal cell fate specification; olfactory bulb development; stem cell maintenance; cerebral cortex regionalization; negative regulation of transcription from RNA polymerase II promoter; trophectodermal cell differentiation; cerebral cortex neuron differentiation; cardioblast differentiation; mesoderm formation; endoderm formation; interferon-gamma production; positive regulation of transcription from RNA polymerase II promoter; brain development; positive regulation of cell differentiation

Research Articles on EOMES

Similar Products

Product Notes

The EOMES eomes (Catalog #AAA3204190) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EOMES antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's EOMES can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EOMES eomes for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YTSACKRRRL SPSNSSNENS PSIKCEDINA EEYSKDTSKG MGGYYAFYTT. It is sometimes possible for the material contained within the vial of "EOMES, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.