Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-ENSA Polyclonal Antibody)

Rabbit anti-Mouse ENSA Polyclonal Antibody | anti-ENSA antibody

ENSA Polyclonal Antibody

Gene Names
ENSA; ARPP-19e
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purification
Synonyms
ENSA; Polyclonal Antibody; ENSA Polyclonal Antibody; ARPP-19e; alpha-endosulfine; anti-ENSA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
3.1 mg/ml (varies by lot)
Sequence Length
121
Applicable Applications for anti-ENSA antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ENSA (NP_996929.1).
Immunogen Sequence
MAGGLGCDVCYWFVEDTQEKEGILPERAEEAKLKAKYPSLGQKPGGSDFLMKRLQKGQKYFDSGDYNMAKAKMKNKQLPSAGPDKNLVTGDHIPTPQDLP
Positive Samples
Mouse Brain, Mouse Liver
Cellular Location
Cytoplasm
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-ENSA Polyclonal Antibody)

Western Blot (WB) (Western blot-ENSA Polyclonal Antibody)
Related Product Information for anti-ENSA antibody
The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 11kDa; 12kDa; 13kDa; 14kDa; 15kDa
Observed: 13kDa
NCBI Official Full Name
alpha-endosulfine isoform 3
NCBI Official Synonym Full Names
endosulfine alpha
NCBI Official Symbol
ENSA
NCBI Official Synonym Symbols
ARPP-19e
NCBI Protein Information
alpha-endosulfine
UniProt Protein Name
Alpha-endosulfine
Protein Family
UniProt Gene Name
ENSA
UniProt Entry Name
ENSA_HUMAN

NCBI Description

The protein encoded by this gene belongs to a highly conserved cAMP-regulated phosphoprotein (ARPP) family. This protein was identified as an endogenous ligand for the sulfonylurea receptor, ABCC8/SUR1. ABCC8 is the regulatory subunit of the ATP-sensitive potassium (KATP) channel, which is located on the plasma membrane of pancreatic beta cells and plays a key role in the control of insulin release from pancreatic beta cells. This protein is thought to be an endogenous regulator of KATP channels. In vitro studies have demonstrated that this protein modulates insulin secretion through the interaction with KATP channel, and this gene has been proposed as a candidate gene for type 2 diabetes. At least eight alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq, Jul 2008]

Uniprot Description

ENSA: a cytoplasmic, highly conserved cAMP-regulated phosphoprotein (ARPP) and regulator of ATP-sensitive potassium (KATP) channels. An endogenous ligand for the sulfonylurea receptor, ABCC8, the regulatory subunit of the KATP channel located on the plasma membrane of pancreatic beta cells. Modulates insulin secretion through the interaction with ABCC8, and may be associated with type 2 diabetes. Eight alternatively spliced isoforms have been observed.

Protein type: Inhibitor

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: nucleoplasm; cytoplasm

Molecular Function: phosphatase inhibitor activity; protein phosphatase 2A binding; protein phosphatase type 2A regulator activity; protein phosphatase inhibitor activity; potassium channel inhibitor activity; ion channel inhibitor activity; receptor binding

Biological Process: mitosis; regulation of catalytic activity; transport; cell division; negative regulation of catalytic activity; response to glucose stimulus; mitotic cell cycle; G2/M transition of mitotic cell cycle; regulation of insulin secretion; response to nutrient

Research Articles on ENSA

Similar Products

Product Notes

The ENSA ensa (Catalog #AAA9140410) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENSA Polyclonal Antibody reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ENSA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the ENSA ensa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENSA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.