Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ENPP7Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit ENPP7 Polyclonal Antibody | anti-ENPP7 antibody

ENPP7 Antibody - N-terminal region

Gene Names
ENPP7; NPP7; NPP-7; E-NPP 7; ALK-SMase
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENPP7; Polyclonal Antibody; ENPP7 Antibody - N-terminal region; anti-ENPP7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: WITAQRQGLRAGSFFYPGGNVTYQGVAVTRSRKEGIAHNYKNETEWRANI
Sequence Length
458
Applicable Applications for anti-ENPP7 antibody
Western Blot (WB)
Homology
Human: 100%; Mouse: 86%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ENPP7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ENPP7Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ENPP7Sample Type: 721_B Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ENPP7 antibody
This is a rabbit polyclonal antibody against ENPP7. It was validated on Western Blot

Target Description: ENPP7 converts sphingomyelin to ceramide. It also has phospholipase C activity toward palmitoyl lyso-phosphocholine and does not appear to have nucleotide pyrophosphatase activity.
Product Categories/Family for anti-ENPP7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49kDa
NCBI Official Full Name
ectonucleotide pyrophosphatase/phosphodiesterase family member 7
NCBI Official Synonym Full Names
ectonucleotide pyrophosphatase/phosphodiesterase 7
NCBI Official Symbol
ENPP7
NCBI Official Synonym Symbols
NPP7; NPP-7; E-NPP 7; ALK-SMase
NCBI Protein Information
ectonucleotide pyrophosphatase/phosphodiesterase family member 7
UniProt Protein Name
Ectonucleotide pyrophosphatase/phosphodiesterase family member 7
UniProt Gene Name
ENPP7
UniProt Synonym Gene Names
E-NPP 7; NPP-7; Alk-SMase
UniProt Entry Name
ENPP7_HUMAN

NCBI Description

The protein encoded by this gene is an intestinal alkaline sphingomyelin phosphodiesterase that converts sphingomyelin to ceramide and phosphocholine. The encoded protein is anchored in the cell membrane, and it may function to protect the intestinal mucosa from inflammation and tumorigenesis. This protein is glycosylated and also exhibits lysophosphatidylcholine hydrolase activity. [provided by RefSeq, Oct 2016]

Uniprot Description

ENPP7: Converts sphingomyelin to ceramide. Also has phospholipase C activity toward palmitoyl lyso-phosphocholine. Does not appear to have nucleotide pyrophosphatase activity. Belongs to the nucleotide pyrophosphatase/phosphodiesterase family.

Protein type: Phosphodiesterase; Lipid Metabolism - sphingolipid; Cell cycle regulation; DNA replication; Motility/polarity/chemotaxis; Membrane protein, integral; EC 3.1.4.12

Chromosomal Location of Human Ortholog: 17q25.3

Cellular Component: Golgi apparatus; microvillus; membrane; integral to membrane; plasma membrane

Molecular Function: sphingomyelin phosphodiesterase activity

Biological Process: negative regulation of cell proliferation; sphingomyelin metabolic process; sphingolipid metabolic process; negative regulation of DNA replication; glycosphingolipid metabolic process; sphingomyelin catabolic process

Research Articles on ENPP7

Similar Products

Product Notes

The ENPP7 enpp7 (Catalog #AAA3218415) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENPP7 Antibody - N-terminal region reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ENPP7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENPP7 enpp7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: WITAQRQGLR AGSFFYPGGN VTYQGVAVTR SRKEGIAHNY KNETEWRANI. It is sometimes possible for the material contained within the vial of "ENPP7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.