Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ENPP2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 2ug/ml)

Rabbit anti-Human ENPP2 Polyclonal Antibody | anti-ENPP2 antibody

ENPP2 Antibody-N-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ENPP2; Polyclonal Antibody; ENPP2 Antibody-N-terminal region; ectonucleotide pyrophosphatase/phosphodiesterase family member 2; ITGB4; LPAR1; Dlg4; UBD; ATX; NPP2; ATX-X; PDNP2; LysoPLD; AUTOTAXIN; PD-IALPHA; anti-ENPP2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
QWLTLPDHERPSVYAFYSEQPDFSGHKYGPFGPEMTNPLREIDKIVGQLM
Applicable Applications for anti-ENPP2 antibody
Western Blot (WB)
Protein Size
915 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human ENPP2
Predicted Homology Based on Immunogen Sequence
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 83%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ENPP2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 2ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ENPP2Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 2ug/ml)
Related Product Information for anti-ENPP2 antibody
Description of Target: The protein encoded by this gene functions as both a phosphodiesterase, which cleaves phosphodiester bonds at the 5' end of oligonucleotides, and a phospholipase, which catalyzes production of lysophosphatidic acid (LPA) in extracellular fluids. LPA evokes growth factor-like responses including stimulation of cell proliferation and chemotaxis. This gene product stimulates the motility of tumor cells and has angiogenic properties, and its expression is upregulated in several kinds of carcinomas. The gene product is secreted and further processed to make the biologically active form. Several alternatively spliced transcript variants encoding different isoforms have been identified.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
100kDa
UniProt Protein Name
Ectonucleotide pyrophosphatase/phosphodiesterase family member 2
UniProt Gene Name
ENPP2
UniProt Synonym Gene Names
ATX; PDNP2; E-NPP 2; LysoPLD
UniProt Entry Name
ENPP2_HUMAN

Uniprot Description

ENPP2: Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility- related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor. Belongs to the nucleotide pyrophosphatase/phosphodiesterase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Lipid Metabolism - ether lipid; Phosphodiesterase; Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis; EC 3.1.4.39

Chromosomal Location of Human Ortholog: 8q24.1

Cellular Component: extracellular space; integral to plasma membrane; plasma membrane

Molecular Function: nucleotide diphosphatase activity; phosphodiesterase I activity; nucleic acid binding; hydrolase activity; zinc ion binding; calcium ion binding; transcription factor binding; scavenger receptor activity; alkylglycerophosphoethanolamine phosphodiesterase activity; polysaccharide binding; lysophospholipase activity

Biological Process: G-protein coupled receptor protein signaling pathway; receptor-mediated endocytosis; phospholipid catabolic process; immune response; cell motility; chemotaxis; regulation of angiogenesis; phosphate metabolic process; regulation of cell migration

Similar Products

Product Notes

The ENPP2 enpp2 (Catalog #AAA3249617) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENPP2 Antibody-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ENPP2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ENPP2 enpp2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: QWLTLPDHER PSVYAFYSEQ PDFSGHKYGP FGPEMTNPLR EIDKIVGQLM. It is sometimes possible for the material contained within the vial of "ENPP2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.