Rabbit ENOSF1 Polyclonal Antibody | anti-ENOSF1 antibody

ENOSF1 antibody - N-terminal region

Cat. Num. AAA3213100

• Gene Names: ENOSF1; RTS; FUCD; TYMSAS
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Yeast, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: ENOSF1; Polyclonal Antibody; ENOSF1 antibody - N-terminal region; anti-ENOSF1 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Rabbit, Yeast, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: MVRGRISRLSVRDVRFPTSLGGHGADAMHTDPDYSAAYVVIETDAEDGIK
• Sequence Length: 443

• Applicable Applications for anti-ENOSF1 antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Rabbit: 100%; Yeast: 100%; Zebrafish: 85%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENOSF1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-ENOSF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: MCF7 cell lysateENOSF1 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells)

Related Product Information for anti-ENOSF1 antibody

This is a rabbit polyclonal antibody against ENOSF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene was originally identified as a naturally occurring antisense transcript to the human thymidylate synthase gene. Alternate splice variants have been described, one of which (named rTSalpha) represents an alternate 3'UTR that is complementary to t

Product Categories/Family for anti-ENOSF1 antibody

Polyclonal; Various

NCBI and Uniprot Product Information

• NCBI GI #: 42544119
• NCBI GeneID: 55556
• NCBI Accession #: NP_059982
• NCBI GenBank Nucleotide #: NM_017512
• UniProt Accession #: Q7L5Y1
• Molecular Weight: 50kDa
• NCBI Official Full Name: mitochondrial enolase superfamily member 1 isoform rTSbeta
• NCBI Official Synonym Full Names: enolase superfamily member 1
• NCBI Official Symbol: ENOSF1
• NCBI Official Synonym Symbols: RTS; FUCD; TYMSAS
• NCBI Protein Information: mitochondrial enolase superfamily member 1
• UniProt Protein Name: Mitochondrial enolase superfamily member 1
• Protein Family: Mitochondrial enolase superfamily
• UniProt Gene Name: ENOSF1
• UniProt Synonym Gene Names: RTS; TYMSAS; rTS
• UniProt Entry Name: ENOF1_HUMAN

NCBI Description

This gene can encode a mitochondrial enzyme that is thought to convert L-fuconate to 2-keto-3-deoxy-L-fuconate. This locus was originally identified as the source of antisense RNAs of the adjacent thymidylate synthase gene. Splice variants at this locus may contain an alternate 3' exon that is complementary to the 3'UTR and terminal intron of the thymidylate synthase (TS) RNA and may downregulate TS expression. [provided by RefSeq, Aug 2017]