Acetyl-CoA carboxylase 1 (Acaca) Recombinant Protein | Acaca recombinant protein

Recombinant Rat Acetyl-CoA carboxylase 1 (Acaca), partial

Cat. Num. AAA950263

• Gene Names: Acaca; ACC1; Acac
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Acetyl-CoA carboxylase 1 (Acaca); Recombinant Rat Acetyl-CoA carboxylase 1 (Acaca); partial; ACC-alpha; Acaca recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 116-617. Partial,provide Biotin carboxylation domain
• Sequence: VIEKVLIANNGIAAVKCMRSIRRWSYEMFRNERAIRFVVMVTPEDLKANAEYIKMADHYVPVPGGANNNNYANVELILDIAKRIPVQAVWAGWGHASENPKLPELLLKNGIAFMGPPSQAMWALGDKIASSIVAQTAGIPTLPWSGSGLRVDWQENDFSKRILNVPQDLYEKGYVKDVDDGLKAAEEVGYPVMIKASEGGGGKGIRKVNNADDFPNLFRQVQAEVPGSPIFVMRLAKQSRHLEVQILADQYGNAISLFGRDCSVQRRHQKIIEEAPAAIATPAVFEHMEQCAVKLAKMVGYVSAGTVEYLYSQDGSFYFLELNPRLQVEHPCTEMVADVNLPAAQLQIAMGIPLFRIKDIRMMYGVSPWGDAPIDFENSAHVPCPRGHVIAARITSENPDEGFKPSSGTVQELNFRSNKNVWGYFSVAAAGGLHEFADSQFGHCFSWGENREEAISNMVVALKELSIRGDFRTTVEYLIKLLETESFQLNRIDTGWLDRLIA

• Species: Rat
• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Acaca recombinant protein

Catalyzes the rate-limiting reaction in the biogenesis of long-chain fatty acids. Carries out three functions: biotin carboxyl carrier protein, biotin carboxylase and carboxyltransferase.

Product Categories/Family for Acaca recombinant protein

Cancer

References

"Structure of the coding sequence and primary amino acid sequence of acetyl-coenzyme A carboxylase." Lopez-Casillas F., Bai D.-H., Luo X., Kong I.-S., Hermodson M.A., Kim K.-H. Proc. Natl. Acad. Sci. U.S.A. 85:5784-5788(1988)

NCBI and Uniprot Product Information

• NCBI GeneID: 60581
• UniProt Accession #: P11497; P97902; A1EC79
• Molecular Weight: 57.8 kDa
• NCBI Official Synonym Full Names: acetyl-CoA carboxylase alpha
• NCBI Official Symbol: Acaca
• NCBI Official Synonym Symbols: ACC1; Acac
• NCBI Protein Information: acetyl-CoA carboxylase 1
• UniProt Protein Name: Acetyl-CoA carboxylase 1
• UniProt Gene Name: Acaca
• UniProt Synonym Gene Names: Acac; ACC1
• UniProt Entry Name: ACACA_RAT

NCBI Description

catalyzes the rate-limiting carboxylation of acetyl CoA to malonyl CoA during long-chain fatty acid synthesis [RGD, Feb 2006]

Uniprot Description

ACC1: a subunit of acetyl-CoA carboxylase (ACC), a multifunctional enzyme system. Catalyzes the carboxylation of acetyl-CoA to malonyl-CoA, the rate-limiting step in fatty acid synthesis. Phosphorylation by AMPK or PKA inhibits the enzymatic activity of ACC. ACC-alpha is the predominant isoform in liver, adipocyte and mammary gland. ACC-beta is the major isoform in skeletal muscle and heart. Phosphorylation regulates its activity.

Protein type: Lipid Metabolism - fatty acid biosynthesis; Ligase; EC 6.4.1.2; EC 6.3.4.14; Carbohydrate Metabolism - pyruvate; Carbohydrate Metabolism - propanoate

Cellular Component: actin cytoskeleton; cytoplasm; cytosol; mitochondrion; nucleolus

Molecular Function: acetyl-CoA carboxylase activity; ATP binding; biotin binding; biotin carboxylase activity; kinase binding; metal ion binding

Biological Process: acetyl-CoA metabolic process; fatty acid biosynthetic process; lipid homeostasis; lipid metabolic process; multicellular organismal protein metabolic process; protein homotetramerization; response to drug; response to organic cyclic substance; tissue homeostasis