Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Rabbit anti-Human, Mouse ENOPH1 Polyclonal Antibody | anti-ENOPH1 antibody

ENOPH1 (Enolase-phosphatase E1, 2,3-diketo-5-methylthio-1-phosphopentane Phosphatase, MASA Homolog, MASA, MSTP145, DKFZp586M0524, E1, FLJ12594) (MaxLight 550)

Gene Names
ENOPH1; E1; MASA; mtnC; MST145
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
ENOPH1; Polyclonal Antibody; ENOPH1 (Enolase-phosphatase E1; 2; 3-diketo-5-methylthio-1-phosphopentane Phosphatase; MASA Homolog; MASA; MSTP145; DKFZp586M0524; E1; FLJ12594) (MaxLight 550); anti-ENOPH1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ENOPH1. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-ENOPH1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human ENOPH1, aa1-261 (NP_067027.1).
Immunogen Sequence
MVVLSVPAEVTVILLDIEGTTTPIAFVKDILFPYIEENVKEYLQTHWEEEECQQDVSLLRKQAEEDAHLDGAVPIPAASGNGVDDLQQMIQAVVDNVCWQMSLDRKTTALKQLQGHMWRAAFTAGRMKAEFFADVVPAVRKWREAGMKVYIYSSGSVEAQKLLFGHSTEGDILELVDGHFDTKIGHKVESESYRKIADSIGCSTNNILFLTDVTREASAAEEADVHVAVVVRPGNAGLTDDEKTYYSLITSFSELYLPSST
Conjugate
MaxLight550
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-ENOPH1 antibody
Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).
Product Categories/Family for anti-ENOPH1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
enolase-phosphatase E1 isoform 1
NCBI Official Synonym Full Names
enolase-phosphatase 1
NCBI Official Symbol
ENOPH1
NCBI Official Synonym Symbols
E1; MASA; mtnC; MST145
NCBI Protein Information
enolase-phosphatase E1
UniProt Protein Name
Enolase-phosphatase E1
UniProt Gene Name
ENOPH1
UniProt Entry Name
ENOPH_HUMAN

Uniprot Description

ENOPH1: Bifunctional enzyme that catalyzes the enolization of 2,3-diketo-5-methylthiopentyl-1-phosphate (DK-MTP-1-P) into the intermediate 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate (HK-MTPenyl-1-P), which is then dephosphorylated to form the acireductone 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK- MTPene). Belongs to the HAD-like hydrolase superfamily. MasA/MtnC family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Phosphatase (non-protein); Amino Acid Metabolism - cysteine and methionine; EC 3.1.3.77

Chromosomal Location of Human Ortholog: 4q21.22

Cellular Component: cytosol; nucleus

Molecular Function: acireductone synthase activity; magnesium ion binding

Biological Process: dephosphorylation; methionine salvage; sulfur amino acid metabolic process; polyamine metabolic process

Research Articles on ENOPH1

Similar Products

Product Notes

The ENOPH1 enoph1 (Catalog #AAA6377400) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ENOPH1 (Enolase-phosphatase E1, 2,3-diketo-5-methylthio-1-phosphopentane Phosphatase, MASA Homolog, MASA, MSTP145, DKFZp586M0524, E1, FLJ12594) (MaxLight 550) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's ENOPH1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the ENOPH1 enoph1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "ENOPH1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.