Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Rabbit EN1 Polyclonal Antibody | anti-EN1 antibody

EN1 antibody - C-terminal region

Reactivity
Guinea Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EN1; Polyclonal Antibody; EN1 antibody - C-terminal region; anti-EN1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Guinea Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LMGSANGGPVVKTDSQQPLVWPAWVYCTRYSDRPSSGPRTRKLKKKKNEK
Sequence Length
392
Applicable Applications for anti-EN1 antibody
Western Blot (WB)
Homology
Guinea Pig: 93%; Rabbit: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human EN1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-EN1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)
Related Product Information for anti-EN1 antibody
This is a rabbit polyclonal antibody against EN1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system.Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
homeobox protein engrailed-1
NCBI Official Synonym Full Names
engrailed homeobox 1
NCBI Official Symbol
EN1
NCBI Protein Information
homeobox protein engrailed-1
UniProt Protein Name
Homeobox protein engrailed-1
Protein Family
UniProt Gene Name
EN1
UniProt Synonym Gene Names
Homeobox protein en-1; Hu-En-1
UniProt Entry Name
HME1_HUMAN

NCBI Description

Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008]

Uniprot Description

EN1: Homeobox-containing genes are thought to have a role in controlling development. In Drosophila, the 'engrailed' (en) gene plays an important role during development in segmentation, where it is required for the formation of posterior compartments. Different mutations in the mouse homologs, En1 and En2, produced different developmental defects that frequently are lethal. The human engrailed homologs 1 and 2 encode homeodomain-containing proteins and have been implicated in the control of pattern formation during development of the central nervous system. [provided by RefSeq, Jul 2008]

Protein type: Transcription factor; Cell development/differentiation; DNA-binding

Chromosomal Location of Human Ortholog: 2q14.2

Cellular Component: membrane; nucleus

Biological Process: embryonic forelimb morphogenesis; anatomical structure morphogenesis; multicellular organism growth; negative regulation of transcription from RNA polymerase II promoter; response to cocaine; dorsal/ventral pattern formation; pigmentation; midbrain-hindbrain boundary development; midbrain development; neuron development; positive regulation of transcription from RNA polymerase II promoter; skeletal development; proximal/distal pattern formation; hindbrain development

Research Articles on EN1

Similar Products

Product Notes

The EN1 en1 (Catalog #AAA3224671) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EN1 antibody - C-terminal region reacts with Guinea Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's EN1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EN1 en1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LMGSANGGPV VKTDSQQPLV WPAWVYCTRY SDRPSSGPRT RKLKKKKNEK. It is sometimes possible for the material contained within the vial of "EN1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.