Rabbit EMX2 Polyclonal Antibody | anti-EMX2 antibody

EMX2 Antibody - N-terminal region

Cat. Num. AAA3200530

• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: EMX2; Polyclonal Antibody; EMX2 Antibody - N-terminal region; anti-EMX2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: ESLVAKDSPLPASRSEDPIRPAALSYANSSPINPFLNGFHSAAAAAAGRG
• Sequence Length: 252

• Applicable Applications for anti-EMX2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 92%
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human EMX2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-EMX2 AntibodyParaffin Embedded Tissue: Human Brain, cerebellumAntibody Concentration: 5 ug/mlMagnification: 400X)

Immunohistochemistry (IHC)

(Rabbit Anti-EMX2 AntibodyParaffin Embedded Tissue: Human MuscleCellular Data: Skeletal muscle cellsAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(WB Suggested Anti-EMX2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysate)

Related Product Information for anti-EMX2 antibody

This is a rabbit polyclonal antibody against EMX2. It was validated on Western Blot

Target Description: The homeodomain transcription factor EMX2 is critical for central nervous system and urogenital development. EMX1 along with EMX2 is related to the 'empty spiracles' gene expressed in the developing Drosophila head.

Product Categories/Family for anti-EMX2 antibody

Polyclonal; Transcription Factor; Transcription Regulation; Cell Biology; Developmental Biology; Neuroscience; E3 & Ubiquitin; Membrane & Traffic; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 14149611
• NCBI GeneID: 2018
• NCBI Accession #: NP_004089
• NCBI GenBank Nucleotide #: NM_004098
• UniProt Accession #: Q04743
• Molecular Weight: 28kDa
• NCBI Official Full Name: homeobox protein EMX2 isoform 1
• NCBI Official Synonym Full Names: empty spiracles homeobox 2
• NCBI Official Symbol: EMX2
• NCBI Protein Information: homeobox protein EMX2
• UniProt Protein Name: Homeobox protein EMX2
• Protein Family: Homeobox protein
• UniProt Gene Name: EMX2
• UniProt Entry Name: EMX2_HUMAN

NCBI Description

This gene encodes a homeobox-containing transcription factor that is the homolog to the 'empty spiracles' gene in Drosophila. Research on this gene in humans has focused on its expression in three tissues: dorsal telencephalon, olfactory neuroepithelium, and urogenetial system. It is expressed in the dorsal telencephalon during development in a low rostral-lateral to high caudal-medial gradient and is proposed to pattern the neocortex into defined functional areas. It is also expressed in embryonic and adult olfactory neuroepithelia where it complexes with eukaryotic translation initiation factor 4E (eIF4E) and possibly regulates mRNA transport or translation. In the developing urogenital system, it is expressed in epithelial tissues and is negatively regulated by HOXA10. Alternative splicing results in multiple transcript variants encoding distinct proteins.[provided by RefSeq, Sep 2009]

Uniprot Description

EMX2: Transcription factor, which in cooperation with EMX2, acts to generate the boundary between the roof and archipallium in the developing brain. May function in combinations with OTX1/2 to specify cell fates in the developing central nervous system. Defects in EMX2 are the cause of schizencephaly (SCHZC). Schizencephaly is an extremely rare human congenital disorder characterized by a full-thickness cleft within the cerebral hemispheres. These clefts are lined with gray matter and most commonly involve the parasylvian regions. Large portions of the cerebral hemispheres may be absent and replaced by cerebro- spinal fluid. Belongs to the EMX homeobox family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 10q26.1

Cellular Component: nucleus

Molecular Function: protein binding; sequence-specific DNA binding

Biological Process: response to drug; forebrain cell migration; anterior/posterior pattern formation; neuron differentiation; dentate gyrus development; regulation of transcription, DNA-dependent; cell proliferation in forebrain; cerebral cortex regionalization

Disease: Schizencephaly