Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: ELMO1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human ELMO1 Polyclonal Antibody | anti-ELMO1 antibody

ELMO1 Antibody - middle region

Gene Names
ELMO1; CED12; CED-12; ELMO-1
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
ELMO1; Polyclonal Antibody; ELMO1 Antibody - middle region; anti-ELMO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EQVMRALTTKPSSLDQFKSKLQNLSYTEILKIRQSERMNQEDFQSRPILE
Sequence Length
727
Applicable Applications for anti-ELMO1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ELMO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: ELMO1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: ELMO1Sample Tissue: Human Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-ELMO1 antibody
This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants.
Product Categories/Family for anti-ELMO1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
84 kDa
NCBI Official Full Name
engulfment and cell motility protein 1 isoform 2
NCBI Official Synonym Full Names
engulfment and cell motility 1
NCBI Official Symbol
ELMO1
NCBI Official Synonym Symbols
CED12; CED-12; ELMO-1
NCBI Protein Information
engulfment and cell motility protein 1
UniProt Protein Name
Engulfment and cell motility protein 1
UniProt Gene Name
ELMO1
UniProt Synonym Gene Names
KIAA0281
UniProt Entry Name
ELMO1_HUMAN

NCBI Description

This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013]

Uniprot Description

ELMO1: Involved in cytoskeletal rearrangements required for phagocytosis of apoptotic cells and cell motility. Acts in assocation with DOCK1 and CRK. Was initially proposed to be required in complex with DOCK1 to activate Rac Rho small GTPases. May enhance the guanine nucleotide exchange factor (GEF) activity of DOCK1. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Motility/polarity/chemotaxis; Cytoskeletal

Chromosomal Location of Human Ortholog: 7p14.1

Cellular Component: cytoskeleton; membrane; cytoplasm; plasma membrane; cytosol

Molecular Function: protein binding; SH3 domain binding

Biological Process: viral reproduction; apoptosis; innate immune response; Rac protein signal transduction; cell motility; vascular endothelial growth factor receptor signaling pathway; actin cytoskeleton organization and biogenesis; phagocytosis, engulfment; regulation of defense response to virus by virus

Research Articles on ELMO1

Similar Products

Product Notes

The ELMO1 elmo1 (Catalog #AAA3220509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ELMO1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ELMO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the ELMO1 elmo1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EQVMRALTTK PSSLDQFKSK LQNLSYTEIL KIRQSERMNQ EDFQSRPILE. It is sometimes possible for the material contained within the vial of "ELMO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.