Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-EDNRA AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Rabbit EDNRA Polyclonal Antibody | anti-EDNRA antibody

EDNRA antibody - C-terminal region

Gene Names
EDNRA; ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EDNRA; Polyclonal Antibody; EDNRA antibody - C-terminal region; anti-EDNRA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KNCFQSCLCCCCYQSKSLMTSVPMNGTSIQWKNHDQNNHNTDRSSHKDSM
Sequence Length
318
Applicable Applications for anti-EDNRA antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 79%; Rabbit: 93%; Sheep: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-EDNRA AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)

Western Blot (WB) (WB Suggested Anti-EDNRA AntibodyTitration: 1.0 ug/mlPositive Control: Jurkat Whole Cell)
Related Product Information for anti-EDNRA antibody
This is a rabbit polyclonal antibody against EDNRA. It was validated on Western Blot

Target Description: This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance.
Product Categories/Family for anti-EDNRA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
endothelin-1 receptor isoform b
NCBI Official Synonym Full Names
endothelin receptor type A
NCBI Official Symbol
EDNRA
NCBI Official Synonym Symbols
ETA; ET-A; ETAR; ETRA; MFDA; ETA-R; hET-AR
NCBI Protein Information
endothelin-1 receptor
UniProt Protein Name
Endothelin-1 receptor
Protein Family
UniProt Gene Name
EDNRA
UniProt Synonym Gene Names
ETA; ETRA; ET-A; ETA-R; hET-AR
UniProt Entry Name
EDNRA_HUMAN

NCBI Description

This gene encodes the receptor for endothelin-1, a peptide that plays a role in potent and long-lasting vasoconstriction. This receptor associates with guanine-nucleotide-binding (G) proteins, and this coupling activates a phosphatidylinositol-calcium second messenger system. Polymorphisms in this gene have been linked to migraine headache resistance. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Uniprot Description

EDNRA: Receptor for endothelin-1. Mediates its action by association with G proteins that activate a phosphatidylinositol- calcium second messenger system. The rank order of binding affinities for ET-A is: ET1 > ET2 >> ET3. Belongs to the G-protein coupled receptor 1 family. Endothelin receptor subfamily. EDNRA sub-subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, multi-pass; Receptor, GPCR; Membrane protein, integral; Motility/polarity/chemotaxis; GPCR, family 1

Chromosomal Location of Human Ortholog: 4q31.22

Cellular Component: nuclear membrane; integral to plasma membrane; T-tubule; plasma membrane; lipid raft

Molecular Function: endothelin receptor activity; protein binding; phosphoinositide phospholipase C activity

Biological Process: positive regulation of odontogenesis; elevation of cytosolic calcium ion concentration during G-protein signaling, coupled to IP3 second messenger (phospholipase C activating); neural crest cell development; metabolic process; heart development; response to morphine; smooth muscle cell proliferation; response to lipopolysaccharide; glucose transport; signal transduction; sensory perception of pain; enteric nervous system development; regulation of epithelial cell proliferation; Rho protein signal transduction; histamine secretion; elevation of cytosolic calcium ion concentration; negative regulation of cAMP biosynthetic process; smooth muscle contraction; fibroblast proliferation; regulation of blood pressure; protein kinase C activation; positive regulation of cell proliferation; artery smooth muscle contraction; penile erection; aging; vasoconstriction; in utero embryonic development; glomerular filtration; adenylate cyclase activation; respiratory gaseous exchange; patterning of blood vessels; cell proliferation; G-protein coupled receptor protein signaling pathway; phospholipase C activation; maternal process involved in parturition; response to hypoxia; positive regulation of protein amino acid phosphorylation; positive regulation of release of sequestered calcium ion into cytosol; positive regulation of inflammatory response; negative regulation of apoptosis

Disease: Mandibulofacial Dysostosis With Alopecia; Migraine With Or Without Aura, Susceptibility To, 1

Research Articles on EDNRA

Similar Products

Product Notes

The EDNRA ednra (Catalog #AAA3216253) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDNRA antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's EDNRA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EDNRA ednra for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KNCFQSCLCC CCYQSKSLMT SVPMNGTSIQ WKNHDQNNHN TDRSSHKDSM. It is sometimes possible for the material contained within the vial of "EDNRA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.