Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (EDN3 rabbit polyclonal antibody. Western Blot analysis of EDN3 expression in human placenta.)

Rabbit anti-Human EDN3 Polyclonal Antibody | anti-EDN3 antibody

EDN3 (Endothelin 3, ET3, Endothelin-3, ET-3, Preproendothelin-3, PPET3, MGC15067, MGC61498) (HRP)

Gene Names
EDN3; ET3; ET-3; WS4B; HSCR4; PPET3
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
EDN3; Polyclonal Antibody; EDN3 (Endothelin 3; ET3; Endothelin-3; ET-3; Preproendothelin-3; PPET3; MGC15067; MGC61498) (HRP); anti-EDN3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human EDN3.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-EDN3 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human EDN3, aa1-238 (NP_000105.1).
Immunogen Sequence
MEPGLWLLFGLTVTSAAGFVPCSQSGDAGRRGVSQAPTAARSEGDCEETVAGPGEETVAGPGEGTVAPTALQGPSPGSPGQEQAAEGAPEHHRSRRCTCFTYKDKECVYYCHLDIIWINTPEQTVPYGLSNYRGSFRGKRSAGPLPGNLQLSHRPHLRCACVGRYDKACLHFCTQTLDVSSNSRTAEKTDKEEEGKVEVKDQQSKQALDLHHPKLMPGSGLALAPSTCPRCLFQEGAP
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(EDN3 rabbit polyclonal antibody. Western Blot analysis of EDN3 expression in human placenta.)

Western Blot (WB) (EDN3 rabbit polyclonal antibody. Western Blot analysis of EDN3 expression in human placenta.)

Western Blot (WB)

(Western Blot analysis of EDN3 expression in transfected 293T cell line by EDN3 polyclonal antibody. Lane 1: EDN3 transfected lysate (25.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of EDN3 expression in transfected 293T cell line by EDN3 polyclonal antibody. Lane 1: EDN3 transfected lysate (25.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-EDN3 antibody
Endothelins are endothelium-derived vasoconstrictor peptides.
Product Categories/Family for anti-EDN3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,454 Da
NCBI Official Full Name
endothelin-3 isoform 1 preproprotein
NCBI Official Synonym Full Names
endothelin 3
NCBI Official Symbol
EDN3
NCBI Official Synonym Symbols
ET3; ET-3; WS4B; HSCR4; PPET3
NCBI Protein Information
endothelin-3; preproendothelin-3
UniProt Protein Name
Endothelin-3
Protein Family
UniProt Gene Name
EDN3
UniProt Synonym Gene Names
ET-3; PPET3
UniProt Entry Name
EDN3_HUMAN

Uniprot Description

EDN3: Endothelins are endothelium-derived vasoconstrictor peptides. Defects in EDN3 are the cause of Hirschsprung disease type 4 (HSCR4); also known as aganglionic megacolon (MGC). A genetic disorder of neural crest development characterized by the absence of intramural ganglion cells in the hindgut; often resulting in intestinal obstruction. Defects in EDN3 are a cause of congenital central hypoventilation syndrome (CCHS); also known as congenital failure of autonomic control or Ondine curse. CCHS is a rare disorder characterized by abnormal control of respiration in the absence of neuromuscular or lung disease, or an identifiable brain stem lesion. A deficiency in autonomic control of respiration results in inadequate or negligible ventilatory and arousal responses to hypercapnia and hypoxemia. Defects in EDN3 are a cause of Waardenburg syndrome type 4 (WS4B); also known as Waardenburg-Shah syndrome. WS4B is characterized by the association of Waardenburg features (depigmentation and deafness) and the absence of enteric ganglia in the distal part of the intestine (Hirschsprung disease). Belongs to the endothelin/sarafotoxin family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 20q13.2-q13.3

Cellular Component: extracellular region; extracellular space

Molecular Function: endothelin B receptor binding; hormone activity; receptor binding

Biological Process: artery smooth muscle contraction; blood circulation; cell surface receptor linked signal transduction; cell-cell signaling; inositol phosphate-mediated signaling; multicellular organismal development; neutrophil chemotaxis; peptide hormone secretion; positive regulation of cell differentiation; positive regulation of cell proliferation; positive regulation of heart rate; positive regulation of hormone secretion; positive regulation of leukocyte chemotaxis; positive regulation of MAP kinase activity; positive regulation of mitosis; regulation of gene expression; regulation of systemic arterial blood pressure by endothelin; signal transduction; vasoconstriction; vein smooth muscle contraction

Disease: Central Hypoventilation Syndrome, Congenital; Hirschsprung Disease, Susceptibility To, 4; Waardenburg Syndrome, Type 4b

Similar Products

Product Notes

The EDN3 edn3 (Catalog #AAA6376979) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDN3 (Endothelin 3, ET3, Endothelin-3, ET-3, Preproendothelin-3, PPET3, MGC15067, MGC61498) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the EDN3 edn3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "EDN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.