Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human stomach using EDIL3 antibody at dilution of 1:100 (40x lens).)
Rabbit anti-Human EDIL3 Polyclonal Antibody | anti-EDIL3 antibody
EDIL3 Polyclonal Antibody
Gene Names
EDIL3; DEL1
Reactivity
Human
Applications
Immunohistochemistry
Purity
Affinity Purification
Synonyms
EDIL3; Polyclonal Antibody; EDIL3 Polyclonal Antibody; DEL1; anti-EDIL3 antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Sequence
YSNDGKTWAMYKVKGTNEDMVFRGNIDNNTPYANSFTPPIKAQYVRLYPQVCRRHCTLRMELLGCELSGCSEPLGMKSGHIQDYQITASSIFRTLNMDMFTWEPRKARLDKQGKVNAWTSGHNDQSQWLQVDLLVPTKVTGIITQGAKDFGHVQFVGSYKLAYSNDGEHWTVYQDEKQRKDKVFQGNFDNDTHRKNVIDPPIYARHIRILPWSWYGRITLRSELLGCTEEE
Sequence Length
470
Applicable Applications for anti-EDIL3 antibody
Immunohistochemistry (IHC)
Application Notes
IHC: 1:50 - 1:200
Immunogen
Recombinant protein of human EDIL3
Immunogen Species
Human
Storage Buffer
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Cellular Location
Secreted
Preparation and Storage
Store at -20 degree C. Avoid freeze / thaw cycles.
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human stomach using EDIL3 antibody at dilution of 1:100 (40x lens).)
Immunohistochemistry (IHC)
(Immunohistochemistry of paraffin-embedded human stomach using EDIL3 antibody at dilution of 1:100 (40x lens).)
Related Product Information for anti-EDIL3 antibody
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior.
Product Categories/Family for anti-EDIL3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
52kDa/53kDa
NCBI Official Full Name
EGF-like repeat and discoidin I-like domain-containing protein 3 isoform 2
NCBI Official Synonym Full Names
EGF like repeats and discoidin domains 3
NCBI Official Symbol
EDIL3
NCBI Official Synonym Symbols
DEL1
NCBI Protein Information
EGF-like repeat and discoidin I-like domain-containing protein 3
UniProt Protein Name
EGF-like repeat and discoidin I-like domain-containing protein 3
UniProt Gene Name
EDIL3
UniProt Synonym Gene Names
DEL1
NCBI Description
The protein encoded by this gene is an integrin ligand. It plays an important role in mediating angiogenesis and may be important in vessel wall remodeling and development. It also influences endothelial cell behavior. [provided by RefSeq, Jul 2008]
Uniprot Description
Promotes adhesion of endothelial cells through interaction with the alpha-v/beta-3 integrin receptor. Inhibits formation of vascular-like structures. May be involved in regulation of vascular morphogenesis of remodeling in embryonic development.
Research Articles on EDIL3
Similar Products
Product Notes
The EDIL3 edil3 (Catalog #AAA9133433) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EDIL3 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's EDIL3 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC). IHC: 1:50 - 1:200. Researchers should empirically determine the suitability of the EDIL3 edil3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YSNDGKTWAM YKVKGTNEDM VFRGNIDNNT PYANSFTPPI KAQYVRLYPQ VCRRHCTLRM ELLGCELSGC SEPLGMKSGH IQDYQITASS IFRTLNMDMF TWEPRKARLD KQGKVNAWTS GHNDQSQWLQ VDLLVPTKVT GIITQGAKDF GHVQFVGSYK LAYSNDGEHW TVYQDEKQRK DKVFQGNFDN DTHRKNVIDP PIYARHIRIL PWSWYGRITL RSELLGCTEE E. It is sometimes possible for the material contained within the vial of "EDIL3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
