Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: EBI3Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

Rabbit EBI3 Polyclonal Antibody | anti-EBI3 antibody

EBI3 antibody - middle region

Gene Names
EBI3; IL27B; IL35B; IL-27B
Reactivity
Dog, Guinea Pig, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
EBI3; Polyclonal Antibody; EBI3 antibody - middle region; anti-EBI3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TAVHPWGSSSSFVPFITEHIIKPDPPEGVRLSPLAERQLQVQWEPPGSWP
Sequence Length
229
Applicable Applications for anti-EBI3 antibody
Western Blot (WB)
Homology
Dog: 91%; Guinea Pig: 93%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human EBI3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: EBI3Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: EBI3Sample Tissue: Human U937 Whole CellAntibody Dilution: 1ug/ml)
Related Product Information for anti-EBI3 antibody
This is a rabbit polyclonal antibody against EBI3. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells.
Product Categories/Family for anti-EBI3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
interleukin-27 subunit beta
NCBI Official Synonym Full Names
Epstein-Barr virus induced 3
NCBI Official Symbol
EBI3
NCBI Official Synonym Symbols
IL27B; IL35B; IL-27B
NCBI Protein Information
interleukin-27 subunit beta
UniProt Protein Name
Interleukin-27 subunit beta
Protein Family
UniProt Gene Name
EBI3
UniProt Synonym Gene Names
IL27B; IL-27 subunit beta; IL-27B; EBV-induced gene 3 protein
UniProt Entry Name
IL27B_HUMAN

NCBI Description

This gene was identified by its induced expression in B lymphocytes in response Epstein-Barr virus infection. It encodes a secreted glycoprotein belonging to the hematopoietin receptor family, and heterodimerizes with a 28 kDa protein to form interleukin 27 (IL-27). IL-27 regulates T cell and inflammatory responses, in part by activating the Jak/STAT pathway of CD4+ T cells. [provided by RefSeq, Sep 2008]

Uniprot Description

IL27-beta: Cytokine with pro- and anti-inflammatory properties, that can regulate T-helper cell development, suppress T-cell proliferation, stimulate cytotoxic T-cell activity, induce isotype switching in B-cells, and that has diverse effects on innate immune cells. Among its target cells are CD4 T-helper cells which can differentiate in type 1 effector cells (TH1), type 2 effector cells (TH2) and IL17 producing helper T-cells (TH17). It drives rapid clonal expansion of naive but not memory CD4 T-cells. It also strongly synergizes with IL-12 to trigger interferon- gamma/IFN-gamma production of naive CD4 T-cells, binds to the cytokine receptor WSX-1/TCCR. Another important role of IL27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines. Belongs to the type I cytokine receptor family. Type 3 subfamily.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19p13.3

Cellular Component: extracellular space; plasma membrane

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; interleukin-27 receptor binding; cytokine activity

Biological Process: T-helper 1 type immune response; cytokine and chemokine mediated signaling pathway; positive regulation of alpha-beta T cell proliferation; humoral immune response; positive regulation of interferon-gamma biosynthetic process

Research Articles on EBI3

Similar Products

Product Notes

The EBI3 ebi3 (Catalog #AAA3206274) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The EBI3 antibody - middle region reacts with Dog, Guinea Pig, Human and may cross-react with other species as described in the data sheet. AAA Biotech's EBI3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the EBI3 ebi3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TAVHPWGSSS SFVPFITEHI IKPDPPEGVR LSPLAERQLQ VQWEPPGSWP. It is sometimes possible for the material contained within the vial of "EBI3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.