Western Blot (WB)
(WB Suggested Anti-Dtx3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)
Rabbit Dtx3 Polyclonal Antibody | anti-DTX3 antibody
Dtx3 antibody - C-terminal region
Gene Names
Dtx3; mg310; Deltex3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Dtx3; Polyclonal Antibody; Dtx3 antibody - C-terminal region; anti-DTX3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: YEKYGTIVIQYVFPPGVQGAEHPNPGVRYPGTTRVAYLPDCPEGNKVLTL
Sequence Length
347
Applicable Applications for anti-DTX3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 79%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Dtx3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)
Western Blot (WB)
(WB Suggested Anti-Dtx3 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Brain)
Related Product Information for anti-DTX3 antibody
This is a rabbit polyclonal antibody against Dtx3. It was validated on Western Blot
Target Description: Dtx3 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Dtx3 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Dtx3 functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.
Target Description: Dtx3 is a regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Dtx3 probably acts both as a positive and negative regulator of Notch, depending on the developmental and cell context. Dtx3 functions as an ubiquitin ligase protein in vitro, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity.
Product Categories/Family for anti-DTX3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
probable E3 ubiquitin-protein ligase DTX3 isoform 1
NCBI Official Synonym Full Names
deltex 3, E3 ubiquitin ligase
NCBI Official Symbol
Dtx3
NCBI Official Synonym Symbols
mg310; Deltex3
NCBI Protein Information
probable E3 ubiquitin-protein ligase DTX3
UniProt Protein Name
Probable E3 ubiquitin-protein ligase DTX3
Protein Family
UniProt Gene Name
Dtx3
UniProt Synonym Gene Names
Deltex3; mDTX3
UniProt Entry Name
DTX3_MOUSE
Similar Products
Product Notes
The DTX3 dtx3 (Catalog #AAA3206886) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dtx3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's Dtx3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DTX3 dtx3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: YEKYGTIVIQ YVFPPGVQGA EHPNPGVRYP GTTRVAYLPD CPEGNKVLTL. It is sometimes possible for the material contained within the vial of "Dtx3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
