Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DSG3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Rabbit anti-Human DSG3 Polyclonal Antibody | anti-DSG3 antibody

DSG3 antibody - C-terminal region

Gene Names
DSG3; PVA; CDHF6
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DSG3; Polyclonal Antibody; DSG3 antibody - C-terminal region; anti-DSG3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KKLAEISLGVDGEGKEVQPPSKDSGYGIESCGHPIEVQQTGFVKCQTLSG
Sequence Length
999
Applicable Applications for anti-DSG3 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DSG3
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DSG3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)

Western Blot (WB) (WB Suggested Anti-DSG3 AntibodyTitration: 1.0 ug/mlPositive Control: HepG2 Whole Cell)
Related Product Information for anti-DSG3 antibody
This is a rabbit polyclonal antibody against DSG3. It was validated on Western Blot

Target Description: Desmosomes are cell-cell junctions between epithelial, myocardial, and certain other cell types. Desmoglein 3 is a calcium-binding transmembrane glycoprotein component of desmosomes in vertebrate epithelial cells. Currently, three desmoglein subfamily members have been identified and all are members of the cadherin cell adhesion molecule superfamily. These desmoglein gene family members are located in a cluster on chromosome 18. This protein has been identified as the autoantigen of the autoimmune skin blistering disease pemphigus vulgaris.
Product Categories/Family for anti-DSG3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
desmoglein-3 preproprotein
NCBI Official Synonym Full Names
desmoglein 3
NCBI Official Symbol
DSG3
NCBI Official Synonym Symbols
PVA; CDHF6
NCBI Protein Information
desmoglein-3
UniProt Protein Name
Desmoglein-3
Protein Family
UniProt Gene Name
DSG3
UniProt Synonym Gene Names
CDHF6; PVA
UniProt Entry Name
DSG3_HUMAN

NCBI Description

This gene encodes a member of the desmoglein family and cadherin cell adhesion molecule superfamily of proteins. Desmogleins are calcium-binding transmembrane glycoprotein components of desmosomes, cell-cell junctions between epithelial, myocardial, and other cell types. The encoded preproprotein is proteolytically processed to generate the mature glycoprotein. This gene is present in a gene cluster with other desmoglein gene family members on chromosome 18. The encoded protein has been identified as the autoantigen of the autoimmune blistering disease pemphigus vulgaris. [provided by RefSeq, Jan 2016]

Uniprot Description

DSG3: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion.

Protein type: Membrane protein, integral; Cell adhesion

Chromosomal Location of Human Ortholog: 18q12.1

Cellular Component: desmosome; plasma membrane; integral to membrane; cytosol

Molecular Function: calcium ion binding

Biological Process: apoptosis; homophilic cell adhesion; cell structure disassembly during apoptosis

Research Articles on DSG3

Similar Products

Product Notes

The DSG3 dsg3 (Catalog #AAA3215153) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DSG3 antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DSG3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DSG3 dsg3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KKLAEISLGV DGEGKEVQPP SKDSGYGIES CGHPIEVQQT GFVKCQTLSG. It is sometimes possible for the material contained within the vial of "DSG3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.