Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (PPP3R1 rabbit polyclonal antibody. Western Blot analysis of PPP3R1 expression in human liver.)

Rabbit anti-Human PPP3R1 Polyclonal Antibody | anti-PPP3R1 antibody

PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (HRP)

Gene Names
PPP3R1; CNB; CNB1; CALNB1
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PPP3R1; Polyclonal Antibody; PPP3R1 (CNA2; CNB; Calcineurin Subunit B Type 1; Protein Phosphatase 2B Regulatory Subunit 1; Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (HRP); anti-PPP3R1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human PPP3R1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Horseradish Peroxidase (HRP).
Applicable Applications for anti-PPP3R1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human PPP3R1, aa1-170 (NP_000936.1).
Immunogen Sequence
MGNEASYPLEMCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQQIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV
Conjugate
HRP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(PPP3R1 rabbit polyclonal antibody. Western Blot analysis of PPP3R1 expression in human liver.)

Western Blot (WB) (PPP3R1 rabbit polyclonal antibody. Western Blot analysis of PPP3R1 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of PPP3R1 expression in transfected 293T cell line by PPP3R1 polyclonal antibody. Lane 1: PPP3R1 transfected lysate (19.3kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of PPP3R1 expression in transfected 293T cell line by PPP3R1 polyclonal antibody. Lane 1: PPP3R1 transfected lysate (19.3kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-PPP3R1 antibody
PPP3R1 is regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.
Product Categories/Family for anti-PPP3R1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,300 Da
NCBI Official Full Name
calcineurin subunit B type 1
NCBI Official Synonym Full Names
protein phosphatase 3, regulatory subunit B, alpha
NCBI Official Symbol
PPP3R1
NCBI Official Synonym Symbols
CNB; CNB1; CALNB1
NCBI Protein Information
calcineurin subunit B type 1; calcineurin B, type I (19kDa); protein phosphatase 2B regulatory subunit 1; protein phosphatase 2B regulatory subunit B alpha; protein phosphatase 3 (formerly 2B), regulatory subunit B (19kD), alpha isoform (calcineurin B, ty
UniProt Protein Name
Calcineurin subunit B type 1
UniProt Gene Name
PPP3R1
UniProt Synonym Gene Names
CNA2; CNB
UniProt Entry Name
CANB1_HUMAN

Uniprot Description

PPP3R1: Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity. Belongs to the calcineurin regulatory subunit family.

Protein type: Protein phosphatase, regulatory subunit; Cell development/differentiation; Apoptosis; Motility/polarity/chemotaxis

Chromosomal Location of Human Ortholog: 2p15

Cellular Component: nucleoplasm; cytosol; calcineurin complex; sarcolemma

Molecular Function: calmodulin binding; protein domain specific binding; protein binding; calcium-dependent protein serine/threonine phosphatase activity; calcium ion binding

Biological Process: calcineurin-NFAT signaling pathway; positive regulation of NFAT protein import into nucleus; dephosphorylation; apoptosis; innate immune response; positive regulation of transcription from RNA polymerase II promoter

Research Articles on PPP3R1

Similar Products

Product Notes

The PPP3R1 ppp3r1 (Catalog #AAA6390476) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The PPP3R1 (CNA2, CNB, Calcineurin Subunit B Type 1, Protein Phosphatase 2B Regulatory Subunit 1, Protein Phosphatase 3 Regulatory Subunit B alpha Isoform 1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP3R1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PPP3R1 ppp3r1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PPP3R1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.