Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DRD5Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human DRD5 Polyclonal Antibody | anti-DRD5 antibody

DRD5 Antibody - C-terminal region

Gene Names
DRD5; DBDR; DRD1B; DRD1L2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DRD5; Polyclonal Antibody; DRD5 Antibody - C-terminal region; anti-DRD5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: IVFHKEIAAAYIHMMPNAVTPGNREVDNDEEEGPFDRMFQIYQTSPDGDP
Sequence Length
477
Applicable Applications for anti-DRD5 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DRD5
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DRD5Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DRD5Sample Tissue: Human 293T Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DRD5 antibody
This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2.
Product Categories/Family for anti-DRD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
53 kDa
NCBI Official Full Name
D(1B) dopamine receptor
NCBI Official Synonym Full Names
dopamine receptor D5
NCBI Official Symbol
DRD5
NCBI Official Synonym Symbols
DBDR; DRD1B; DRD1L2
NCBI Protein Information
D(1B) dopamine receptor
UniProt Protein Name
D(1B) dopamine receptor
Protein Family
UniProt Gene Name
DRD5
UniProt Synonym Gene Names
DRD1B; DRD1L2
UniProt Entry Name
DRD5_HUMAN

NCBI Description

This gene encodes the D5 subtype of the dopamine receptor. The D5 subtype is a G-protein coupled receptor which stimulates adenylyl cyclase. This receptor is expressed in neurons in the limbic regions of the brain. It has a 10-fold higher affinity for dopamine than the D1 subtype. Pseudogenes related to this gene reside on chromosomes 1 and 2. [provided by RefSeq, Jul 2008]

Uniprot Description

DRD5: Dopamine receptor whose activity is mediated by G proteins which activate adenylyl cyclase. Defects in DRD5 are a cause of benign essential blepharospasm (BEB). BEB is a primary focal dystonia affecting the orbicularis oculi muscles. Dystonia is defined by the presence of sustained involuntary muscle contraction, often leading to abnormal postures. BEB usually begins in middle age. Initial symptoms include eye irritation and frequent blinking, progressing to involuntary spasms of eyelid closure. Patients have normal eyes. The visual disturbance is due solely to the forced closure of the eyelids. In severe cases, this can lead to functional blindness. Belongs to the G-protein coupled receptor 1 family.

Protein type: GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral; Receptor, GPCR

Chromosomal Location of Human Ortholog: 4p16.1

Cellular Component: brush border membrane; integral to plasma membrane; plasma membrane

Molecular Function: dopamine receptor activity; dopamine binding; dopamine D1 receptor-like receptor activity

Biological Process: synaptic transmission, dopaminergic; wound healing; adenylate cyclase activation; response to amphetamine; transmission of nerve impulse; norepinephrine-epinephrine vasoconstriction involved in regulation of systemic arterial blood pressure; response to cocaine; G-protein signaling, adenylate cyclase activating pathway; cellular calcium ion homeostasis; synaptic transmission; regulation of female receptivity; regulation of systemic arterial blood pressure by vasopressin; sensitization; negative regulation of blood pressure; dopamine receptor, phospholipase C activating pathway; positive regulation of adenylate cyclase activity; negative regulation of NAD(P)H oxidase activity; associative learning; dopamine receptor, adenylate cyclase activating pathway

Disease: Attention Deficit-hyperactivity Disorder; Blepharospasm, Benign Essential

Research Articles on DRD5

Similar Products

Product Notes

The DRD5 drd5 (Catalog #AAA3220784) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DRD5 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DRD5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DRD5 drd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: IVFHKEIAAA YIHMMPNAVT PGNREVDNDE EEGPFDRMFQ IYQTSPDGDP. It is sometimes possible for the material contained within the vial of "DRD5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.