Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: Dnmt1Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human Dnmt1 Polyclonal Antibody | anti-DNMT1 antibody

Dnmt1 Antibody - Middle region

Gene Names
DNMT1; AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
Dnmt1; Polyclonal Antibody; Dnmt1 Antibody - Middle region; anti-DNMT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PNMAMKEADDDEEVDDNIPEMPSPKKMHQG
Sequence Length
1616
Applicable Applications for anti-DNMT1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the Middle region of Human Dnmt1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: Dnmt1Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: Dnmt1Sample Type: Jurkat Whole CellAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DNMT1 antibody
This is a rabbit polyclonal antibody against Dnmt1. It was validated on Western Blot

Target Description: DNA (cytosine-5-)-methyltransferase 1 has a role in the
establishment and regulation of tissue-specific patterns of
methylated cytosine residues. Aberrant methylation patterns are
associated with certain human tumors and developmental
abnormalities. Two transcript variants encoding different isoforms
have been found for this gene.
Product Categories/Family for anti-DNMT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
183 kDa
NCBI Official Full Name
DNA (cytosine-5)-methyltransferase 1 isoform b
NCBI Official Synonym Full Names
DNA methyltransferase 1
NCBI Official Symbol
DNMT1
NCBI Official Synonym Symbols
AIM; DNMT; MCMT; CXXC9; HSN1E; ADCADN; m.HsaI
NCBI Protein Information
DNA (cytosine-5)-methyltransferase 1
UniProt Protein Name
DNA (cytosine-5)-methyltransferase 1
UniProt Gene Name
DNMT1
UniProt Synonym Gene Names
AIM; CXXC9; DNMT; Dnmt1; DNA MTase HsaI; M.HsaI
UniProt Entry Name
DNMT1_HUMAN

NCBI Description

This gene encodes an enzyme that transfers methyl groups to cytosine nucleotides of genomic DNA. This protein is the major enzyme responsible for maintaining methylation patterns following DNA replication and shows a preference for hemi-methylated DNA. Methylation of DNA is an important component of mammalian epigenetic gene regulation. Aberrant methylation patterns are found in human tumors and associated with developmental abnormalities. Variation in this gene has been associated with cerebellar ataxia, deafness, and narcolepsy, and neuropathy, hereditary sensory, type IE. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

DNMT1: an ubiquitous DNA methyltransferase that methylates CpG residues. Preferentially methylates hemimethylated DNA. It is responsible for maintaining methylation patterns established in development, and may play an active role in DNA damage repair. Mediates transcriptional repression by direct binding to HDAC2. Its abundance is reduced to non detectable levels at the G0 phase of the cell cycle and is dramatically induced upon entrance into the S-phase of the cell cycle. Interacts with HDAC1 and with PCNA. Forms a complex with DMAP1 and HDAC2, with direct interaction. Forms also a stable complex with E2F1, BB1 and HDAC1. Binds MBD2 and MBD3. Three isoforms of the human protein produced by alternative splicing have been described.

Protein type: Methyltransferase, DNA; EC 2.1.1.37; Cell development/differentiation; Methyltransferase; Transcription regulation; Amino Acid Metabolism - cysteine and methionine

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; centric heterochromatin; replication fork; nucleus

Molecular Function: DNA (cytosine-5-)-methyltransferase activity; protein binding; methyl-CpG binding; DNA binding; zinc ion binding; RNA binding; chromatin binding; DNA-methyltransferase activity; transcription factor binding

Biological Process: negative regulation of histone H3-K9 methylation; transcription, DNA-dependent; maintenance of DNA methylation; negative regulation of gene expression, epigenetic; DNA methylation; gene expression; negative regulation of transcription from RNA polymerase II promoter; positive regulation of histone H3-K4 methylation; chromatin modification; gene silencing; regulation of gene expression, epigenetic; DNA methylation on cytosine; regulation of cell proliferation

Disease: Cerebellar Ataxia, Deafness, And Narcolepsy, Autosomal Dominant; Neuropathy, Hereditary Sensory, Type Ie

Research Articles on DNMT1

Similar Products

Product Notes

The DNMT1 dnmt1 (Catalog #AAA3200099) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Dnmt1 Antibody - Middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Dnmt1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNMT1 dnmt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PNMAMKEADD DEEVDDNIPE MPSPKKMHQG. It is sometimes possible for the material contained within the vial of "Dnmt1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.