Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DNAJA1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DNAJA1 Polyclonal Antibody | anti-DNAJA1 antibody

DNAJA1 Antibody - C-terminal region

Gene Names
DNAJA1; DJ-2; DjA1; HDJ2; HSDJ; HSJ2; HSJ-2; HSPF4; NEDD7; hDJ-2
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DNAJA1; Polyclonal Antibody; DNAJA1 Antibody - C-terminal region; anti-DNAJA1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPDKLSLLEKLLPERKEVEETDEMDQVELVDFDPNQERRRHYNGEAYEDD
Sequence Length
397
Applicable Applications for anti-DNAJA1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DNAJA1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DNAJA1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DNAJA1Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DNAJA1 antibody
This gene encodes a member of the DnaJ family of proteins, which act as heat shock protein 70 cochaperones. Heat shock proteins facilitate protein folding, trafficking, prevention of aggregation, and proteolytic degradation. Members of this family are characterized by a highly conserved N-terminal J domain, a glycine/phenylalanine-rich region, four CxxCxGxG zinc finger repeats, and a C-terminal substrate-binding domain. The J domain mediates the interaction with heat shock protein 70 to recruit substrates and regulate ATP hydrolysis activity. In humans, this gene has been implicated in positive regulation of virus replication through co-option by the influenza A virus. Several pseudogenes of this gene are found on other chromosomes.
Product Categories/Family for anti-DNAJA1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
45 kDa
NCBI Official Full Name
dnaJ homolog subfamily A member 1 isoform 1
NCBI Official Synonym Full Names
DnaJ heat shock protein family (Hsp40) member A1
NCBI Official Symbol
DNAJA1
NCBI Official Synonym Symbols
DJ-2; DjA1; HDJ2; HSDJ; HSJ2; HSJ-2; HSPF4; NEDD7; hDJ-2
NCBI Protein Information
dnaJ homolog subfamily A member 1
UniProt Protein Name
DnaJ homolog subfamily A member 1
Protein Family
UniProt Gene Name
DNAJA1
UniProt Synonym Gene Names
DNAJ2; HDJ2; HSJ2; HSPF4; HSJ-2; hDj-2
UniProt Entry Name
DNJA1_HUMAN

NCBI Description

This gene encodes a member of the DnaJ family of proteins, which act as heat shock protein 70 cochaperones. Heat shock proteins facilitate protein folding, trafficking, prevention of aggregation, and proteolytic degradation. Members of this family are characterized by a highly conserved N-terminal J domain, a glycine/phenylalanine-rich region, four CxxCxGxG zinc finger repeats, and a C-terminal substrate-binding domain. The J domain mediates the interaction with heat shock protein 70 to recruit substrates and regulate ATP hydrolysis activity. In humans, this gene has been implicated in positive regulation of virus replication through co-option by the influenza A virus. Several pseudogenes of this gene are found on other chromosomes. [provided by RefSeq, Sep 2015]

Uniprot Description

DNAJA1: Co-chaperone of Hsc70. Seems to play a role in protein import into mitochondria.

Protein type: Chaperone; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 9p13.3

Cellular Component: membrane; mitochondrion; perinuclear region of cytoplasm; cytosol; nucleus; ubiquitin ligase complex

Molecular Function: protein binding; G-protein-coupled receptor binding; low-density lipoprotein receptor binding; chaperone binding; metal ion binding; ubiquitin protein ligase binding; unfolded protein binding; Hsp70 protein binding; ATP binding

Biological Process: negative regulation of JNK activity; protein folding; positive regulation of apoptosis; DNA damage response, detection of DNA damage; response to unfolded protein; regulation of protein transport; sperm motility; response to heat; androgen receptor signaling pathway; spermatogenesis; protein refolding; negative regulation of protein ubiquitination; negative regulation of apoptosis

Research Articles on DNAJA1

Similar Products

Product Notes

The DNAJA1 dnaja1 (Catalog #AAA3221763) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DNAJA1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DNAJA1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DNAJA1 dnaja1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPDKLSLLEK LLPERKEVEE TDEMDQVELV DFDPNQERRR HYNGEAYEDD. It is sometimes possible for the material contained within the vial of "DNAJA1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.