Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DMBT1Sample Tissue: Human Human StomachAntibody Dilution: 1ug/ml)

Rabbit anti-Human DMBT1 Polyclonal Antibody | anti-DMBT1 antibody

DMBT1 antibody - N-terminal region

Gene Names
DMBT1; SAG; GP340; SALSA; muclin
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DMBT1; Polyclonal Antibody; DMBT1 antibody - N-terminal region; anti-DMBT1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SWSTPSPDTLPTITLPASTVGSESSLALRLVNGGDRCQGRVEVLYRGSWG
Sequence Length
2413
Applicable Applications for anti-DMBT1 antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DMBT1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DMBT1Sample Tissue: Human Human StomachAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DMBT1Sample Tissue: Human Human StomachAntibody Dilution: 1ug/ml)

Western Blot (WB)

(Lanes:Lane 1: 2ug MCF7-DMBT1+DoxLane 2: 2ug MCF7-DMBT1 -DoxLane 3: 2ug MCF7-Ctrl+DoxLane 4: 2ug MCF7-DMBT1 -DoxPrimary Antibody Dilution:1:5000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10,000Gene Name:DMBT1Submitted by:Matthias Rauen, Lundbeckfonden Center of Excellence NanoCAN, University of Southern Denmark)

Western Blot (WB) (Lanes:Lane 1: 2ug MCF7-DMBT1+DoxLane 2: 2ug MCF7-DMBT1 -DoxLane 3: 2ug MCF7-Ctrl+DoxLane 4: 2ug MCF7-DMBT1 -DoxPrimary Antibody Dilution:1:5000Secondary Antibody:Anti-rabbit HRPSecondary Antibody Dilution:1:10,000Gene Name:DMBT1Submitted by:Matthias Rauen, Lundbeckfonden Center of Excellence NanoCAN, University of Southern Denmark)

Western Blot (WB)

(WB Suggested Anti-DMBT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Stomach)

Western Blot (WB) (WB Suggested Anti-DMBT1 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Stomach)
Related Product Information for anti-DMBT1 antibody
This is a rabbit polyclonal antibody against DMBT1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. The gene DMBT1 was originally isolated based on its deletion in a medulloblastoma cell line. DMBT1 is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The DMBT1 protein is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor supressor gene, but rather play a role in the interaction of tumor cells and the immune system.
Product Categories/Family for anti-DMBT1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
258kDa
NCBI Official Full Name
deleted in malignant brain tumors 1 protein isoform b
NCBI Official Synonym Full Names
deleted in malignant brain tumors 1
NCBI Official Symbol
DMBT1
NCBI Official Synonym Symbols
SAG; GP340; SALSA; muclin
NCBI Protein Information
deleted in malignant brain tumors 1 protein
UniProt Protein Name
Deleted in malignant brain tumors 1 protein
UniProt Gene Name
DMBT1
UniProt Synonym Gene Names
GP340; Gp-340; SAG

NCBI Description

Loss of sequences from human chromosome 10q has been associated with the progression of human cancers. This gene was originally isolated based on its deletion in a medulloblastoma cell line. This gene is expressed with transcripts of 6.0, 7.5, and 8.0 kb in fetal lung and with one transcript of 8.0 kb in adult lung, although the 7.5 kb transcript has not been characterized. The encoded protein precursor is a glycoprotein containing multiple scavenger receptor cysteine-rich (SRCR) domains separated by SRCR-interspersed domains (SID). Transcript variant 2 (8.0 kb) has been shown to bind surfactant protein D independently of carbohydrate recognition. This indicates that DMBT1 may not be a classical tumor suppressor gene, but rather play a role in the interaction of tumor cells and the immune system. [provided by RefSeq, Mar 2016]

Uniprot Description

May be considered as a candidate tumor suppressor gene for brain, lung, esophageal, gastric, and colorectal cancers. May play roles in mucosal defense system, cellular immune defense and epithelial differentiation. May play a role as an opsonin receptor for SFTPD and SPAR in macrophage tissues throughout the body, including epithelial cells lining the gastrointestinal tract. May play a role in liver regeneration. May be an important factor in fate decision and differentiation of transit-amplifying ductular (oval) cells within the hepatic lineage. Required for terminal differentiation of columnar epithelial cells during early embryogenesis. May function as a binding protein in saliva for the regulation of taste sensation. Binds to HIV-1 envelope protein and has been shown to both inhibit and facilitate viral transmission. Displays a broad calcium-dependent binding spectrum against both Gram-positive and Gram-negative bacteria, suggesting a role in defense against bacterial pathogens. Binds to a range of poly-sulfated and poly-phosphorylated ligands which may explain its broad bacterial-binding specificity. Inhibits cytoinvasion of S.enterica. Associates with the actin cytoskeleton and is involved in its remodeling during regulated exocytosis. Interacts with pancreatic zymogens in a pH-dependent manner and may act as a Golgi cargo receptor in the regulated secretory pathway of the pancreatic acinar cell.

Research Articles on DMBT1

Similar Products

Product Notes

The DMBT1 dmbt1 (Catalog #AAA3206326) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DMBT1 antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DMBT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DMBT1 dmbt1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SWSTPSPDTL PTITLPASTV GSESSLALRL VNGGDRCQGR VEVLYRGSWG. It is sometimes possible for the material contained within the vial of "DMBT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.