Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (DLST rabbit polyclonal antibody. Western Blot analysis of DLST expression in human kidney.)

Rabbit anti-Human DLST Polyclonal Antibody | anti-DLST antibody

DLST (Dihydrolipoyllysine-residue Succinyltransferase Component Of 2-oxoglutarate Dehydrogenase Complex, Mitochondrial, Dihydrolipoamide Succinyltransferase Component Of 2-oxoglutarate Dehydrogenase Complex, E2, E2K, DLTS) (Biotin)

Gene Names
DLST; DLTS
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DLST; Polyclonal Antibody; DLST (Dihydrolipoyllysine-residue Succinyltransferase Component Of 2-oxoglutarate Dehydrogenase Complex; Mitochondrial; Dihydrolipoamide Succinyltransferase Component Of 2-oxoglutarate Dehydrogenase Complex; E2; E2K; DLTS) (Biotin); anti-DLST antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DLST.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-DLST antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DLST, aa1-453 (NP_001924.2).
Immunogen Sequence
MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVFSVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAEDEVVCEIETDKTSVQVPSPANGVIEALLVPDGGKVEGGTPLFTLRKTGAAPAKAKPAEAPAAAAPKAEPTAAAVPPPAAPIPTQMPPVPSPSQPPSGKPVSAVKPTVAPPLAEPGAGKGLRSEHREKMNRMRQRIAQRLKEAQNTCAMLTTFNEIDMSNIQEMRARHKEAFLKKHNLKLGFMSAFVKASAFALQEQPVVNAVIDDTTKEVVYRDYIDISVAVATPRGLVVPVIRNVEAMNFADIERTITELGEKARKNELAIEDMDGGTFTISNGGVFGSLFGTPIINPPQSAILGMHGIFDRPVAIGGKVEVRPMMYVALTYDHRLIDGREAVTFLRKIKAAVEDPRVLLLDL
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(DLST rabbit polyclonal antibody. Western Blot analysis of DLST expression in human kidney.)

Western Blot (WB) (DLST rabbit polyclonal antibody. Western Blot analysis of DLST expression in human kidney.)

Western Blot (WB)

(DLST rabbit polyclonal antibody. Western Blot analysis of DLST expression in HepG2.)

Western Blot (WB) (DLST rabbit polyclonal antibody. Western Blot analysis of DLST expression in HepG2.)

Western Blot (WB)

(Western Blot analysis of DLST expression in transfected 293T cell line by DLST polyclonal antibody. Lane 1: DLST transfected lysate (48.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DLST expression in transfected 293T cell line by DLST polyclonal antibody. Lane 1: DLST transfected lysate (48.8kD). Lane 2: Non-transfected lysate.)
Product Categories/Family for anti-DLST antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39,553 Da
NCBI Official Full Name
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial isoform 1
NCBI Official Synonym Full Names
dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex)
NCBI Official Symbol
DLST
NCBI Official Synonym Symbols
DLTS
NCBI Protein Information
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial; E2K; OGDC-E2
UniProt Protein Name
Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial
Protein Family
UniProt Gene Name
DLST
UniProt Synonym Gene Names
DLTS; OGDC-E2
UniProt Entry Name
ODO2_HUMAN

NCBI Description

This gene encodes a mitochondrial protein that belongs to the 2-oxoacid dehydrogenase family. This protein is one of the three components (the E2 component) of the 2-oxoglutarate dehydrogenase complex that catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2011]

Uniprot Description

DLST: The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of 3 enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3). Forms a 24-polypeptide structural core with octahedral symmetry. Belongs to the 2-oxoacid dehydrogenase family.

Protein type: Mitochondrial; Transferase; EC 2.3.1.61; Carbohydrate Metabolism - citrate (TCA) cycle; Amino Acid Metabolism - lysine degradation

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: membrane; mitochondrial matrix; oxoglutarate dehydrogenase complex; nucleus

Molecular Function: dihydrolipoyllysine-residue succinyltransferase activity

Biological Process: cellular metabolic process; generation of precursor metabolites and energy; tricarboxylic acid cycle; L-lysine catabolic process to acetyl-CoA via saccharopine; lysine catabolic process

Research Articles on DLST

Similar Products

Product Notes

The DLST dlst (Catalog #AAA6376306) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLST (Dihydrolipoyllysine-residue Succinyltransferase Component Of 2-oxoglutarate Dehydrogenase Complex, Mitochondrial, Dihydrolipoamide Succinyltransferase Component Of 2-oxoglutarate Dehydrogenase Complex, E2, E2K, DLTS) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DLST can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DLST dlst for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DLST, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.