Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DLG7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Rabbit DLG7 Polyclonal Antibody | anti-DLGAP5 antibody

DLG7 antibody - N-terminal region

Gene Names
DLGAP5; DLG7; HURP
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DLG7; Polyclonal Antibody; DLG7 antibody - N-terminal region; anti-DLGAP5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EYERNRHFGLKDVNIPTLEGRILVELDETSQELVPEKTNVKPRAMKTILG
Sequence Length
846
Applicable Applications for anti-DLGAP5 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DLG7
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DLG7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)

Western Blot (WB) (WB Suggested Anti-DLG7 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Transfected 293T)
Related Product Information for anti-DLGAP5 antibody
This is a rabbit polyclonal antibody against DLG7. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DLG7 is a potential cell cycle regulator that may play a role in carcinogenesis of cancer cells. It is a mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. DLG7 is the key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells.
Product Categories/Family for anti-DLGAP5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
95kDa
NCBI Official Full Name
disks large-associated protein 5 isoform a
NCBI Official Synonym Full Names
DLG associated protein 5
NCBI Official Symbol
DLGAP5
NCBI Official Synonym Symbols
DLG7; HURP
NCBI Protein Information
disks large-associated protein 5
UniProt Protein Name
Disks large-associated protein 5
UniProt Gene Name
DLGAP5
UniProt Synonym Gene Names
DLG7; KIAA0008; DAP-5; HURP
UniProt Entry Name
DLGP5_HUMAN

Uniprot Description

DLG7: a cell cycle regulator that may play a role in carcinogenesis. Elevated levels of expression detected in the G2/M phase of synchronized cultures of HeLa cells. Required for chromosome congression and alignment. Stabilizes mitotic microtubules, promotes microtubule polymerization and controls spindle formation and dynamics Mitotic phosphoprotein regulated by the ubiquitin-proteasome pathway. Interacts with CDC2 and localizes to the spindle poles in mitotic cells. Interacts with the C-terminal proline-rich region of FBXO7. Recruited by FBXO7 to a SCF (SKP1-CUL1-F-box) protein complex in a CDC2/Cyclin B-phosphorylation dependent manner. Colocalizes with E-cadherin (CDH1) at sites of cell-cell contact in intestinal epithelial cells. Key regulator of adherens junction integrity and differentiation that may be involved in CDH1-mediated adhesion and signaling in epithelial cells. Two alternatively spliced isoforms have been described.

Protein type: Cell cycle regulation; Microtubule-binding

Chromosomal Location of Human Ortholog: 14q22.3

Cellular Component: cytoplasm; microtubule organizing center; spindle pole centrosome; nucleus

Molecular Function: protein binding; phosphoprotein phosphatase activity

Biological Process: cell proliferation; dephosphorylation; cell-cell signaling; positive regulation of mitotic metaphase/anaphase transition; mitotic chromosome movement towards spindle pole

Research Articles on DLGAP5

Similar Products

Product Notes

The DLGAP5 dlgap5 (Catalog #AAA3208108) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DLG7 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DLG7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DLGAP5 dlgap5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EYERNRHFGL KDVNIPTLEG RILVELDETS QELVPEKTNV KPRAMKTILG. It is sometimes possible for the material contained within the vial of "DLG7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.