Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateDIDO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Rabbit DIDO1 Polyclonal Antibody | anti-DIDO1 antibody

DIDO1 antibody - N-terminal region

Gene Names
DIDO1; BYE1; DIO1; DATF1; DIDO2; DIDO3; DIO-1; DATF-1; C20orf158; dJ885L7.8
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DIDO1; Polyclonal Antibody; DIDO1 antibody - N-terminal region; anti-DIDO1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASET
Sequence Length
544
Applicable Applications for anti-DIDO1 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 92%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 100%; Rat: 92%; Yeast: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DIDO1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateDIDO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)

Western Blot (WB) (WB Suggested Anti-DIDO1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysateDIDO1 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells)
Related Product Information for anti-DIDO1 antibody
This is a rabbit polyclonal antibody against DIDO1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. DIDO1 gene is similar to the mouse gene and therefore is thought to be involved in apoptosis.Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59kDa
NCBI Official Full Name
death-inducer obliterator 1 isoform c
NCBI Official Synonym Full Names
death inducer-obliterator 1
NCBI Official Symbol
DIDO1
NCBI Official Synonym Symbols
BYE1; DIO1; DATF1; DIDO2; DIDO3; DIO-1; DATF-1; C20orf158; dJ885L7.8
NCBI Protein Information
death-inducer obliterator 1
UniProt Protein Name
Death-inducer obliterator 1
Protein Family
UniProt Gene Name
DIDO1
UniProt Synonym Gene Names
C20orf158; DATF1; KIAA0333; DIO-1; hDido1; DATF-1
UniProt Entry Name
DIDO1_HUMAN

NCBI Description

Apoptosis, a major form of cell death, is an efficient mechanism for eliminating unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic signals and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic signal activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Alternatively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

DATF1: Putative transcription factor, weakly pro-apoptotic when overexpressed. Tumor suppressor. Ubiquitous. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor

Chromosomal Location of Human Ortholog: 20q13.33

Cellular Component: cytoplasm; spindle; nucleus

Molecular Function: zinc ion binding

Biological Process: transcription, DNA-dependent

Research Articles on DIDO1

Similar Products

Product Notes

The DIDO1 dido1 (Catalog #AAA3202344) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DIDO1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's DIDO1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DIDO1 dido1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ERVEQFLTIA RRRGRRSMPV SLEDSGEPTS CPATDAETAS EGSVESASET. It is sometimes possible for the material contained within the vial of "DIDO1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.