Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: DHPSSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human DHPS Polyclonal Antibody | anti-DHPS antibody

DHPS Antibody - middle region

Gene Names
DHPS; DS; DHS; MIG13
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
DHPS; Polyclonal Antibody; DHPS Antibody - middle region; anti-DHPS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGVVKHHIANANLMRNGADYAVYINTAQEFDGSDSGARPDEAVSWGKIRV
Sequence Length
322
Applicable Applications for anti-DHPS antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human DHPS
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: DHPSSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: DHPSSample Tissue: Human HCT116 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-DHPS antibody
This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Product Categories/Family for anti-DHPS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35 kDa
NCBI Official Full Name
deoxyhypusine synthase isoform d
NCBI Official Synonym Full Names
deoxyhypusine synthase
NCBI Official Symbol
DHPS
NCBI Official Synonym Symbols
DS; DHS; MIG13
NCBI Protein Information
deoxyhypusine synthase
UniProt Protein Name
Deoxyhypusine synthase
UniProt Gene Name
DHPS
UniProt Synonym Gene Names
DS; DHS
UniProt Entry Name
DHYS_HUMAN

NCBI Description

This gene encodes a protein that is required for the formation of hypusine, a unique amino acid formed by the posttranslational modification of only one protein, eukaryotic translation initiation factor 5A. The encoded protein catalyzes the first step in hypusine formation by transferring the butylamine moiety of spermidine to a specific lysine residue of the eukaryotic translation initiation factor 5A precursor, forming an intermediate deoxyhypusine residue. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene. [provided by RefSeq, May 2011]

Uniprot Description

DHPS: Catalyzes the NAD-dependent oxidative cleavage of spermidine and the subsequent transfer of the butylamine moiety of spermidine to the epsilon-amino group of a specific lysine residue of the eIF-5A precursor protein to form the intermediate deoxyhypusine residue. Belongs to the deoxyhypusine synthase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Cell cycle regulation; EC 2.5.1.46; Transferase

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: cytosol

Molecular Function: protein binding; deoxyhypusine synthase activity

Biological Process: cellular protein metabolic process; translation; positive regulation of cell proliferation; positive regulation of T cell proliferation; hypusine biosynthetic process from peptidyl-lysine; post-translational protein modification; glucose homeostasis; spermidine catabolic process to deoxyhypusine, using deoxyhypusine synthase; protein homotetramerization

Research Articles on DHPS

Similar Products

Product Notes

The DHPS dhps (Catalog #AAA3221504) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DHPS Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DHPS can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DHPS dhps for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGVVKHHIAN ANLMRNGADY AVYINTAQEF DGSDSGARPD EAVSWGKIRV. It is sometimes possible for the material contained within the vial of "DHPS, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.