Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- DGAT1 Picoband antibody, MBS178380, Western blottingAll lanes: Anti DGAT1 (MBS178380) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD )

anti-Human, Rat DGAT1 Polyclonal Antibody | anti-DGAT1 antibody

Anti-DGAT1 Antibody

Gene Names
DGAT1; ARAT; DGAT; ARGP1; DIAR7
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
DGAT1; Polyclonal Antibody; Anti-DGAT1 Antibody; Diacylglycerol O-acyltransferase 1; ACAT related gene product 1; ACAT-related gene product 1; Acyl coenzyme A:cholesterol acyltransferase related gene 1; Acyl-CoA retinol O-fatty-acyltransferase; Acyl-CoA:diacylglycerol acyltransferase; ARAT; ARGP1; C75990; D15Ertd23e; Dgat; DGAT1_HUMAN; Diacylglycerol O acyltransferase 1; DIAR7; Diglyceride acyltransferase; EC 2.3.1.20; hCG_24006; MGC139064; Retinol O fatty acyltransferase; diacylglycerol O-acyltransferase 1; anti-DGAT1 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
488
Applicable Applications for anti-DGAT1 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence in the middle region of human DGAT1 (280-318aa RRILEMLFFTQLQVGLIQQWMVPTIQNSMKPFKDMDYSR), different from the related mouse and rat sequences by one amino acid.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- DGAT1 Picoband antibody, MBS178380, Western blottingAll lanes: Anti DGAT1 (MBS178380) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD )

Western Blot (WB) (Anti- DGAT1 Picoband antibody, MBS178380, Western blottingAll lanes: Anti DGAT1 (MBS178380) at 0.5ug/mlLane 1: Rat Kidney Tissue Lysate at 50ugLane 2: HELA Whole Cell Lysate at 40ugPredicted bind size: 60KDObserved bind size: 60KD )
Related Product Information for anti-DGAT1 antibody
Description: Rabbit IgG polyclonal antibody for Diacylglycerol O-acyltransferase 1(DGAT1) detection. Tested with WB in Human;Rat.

Background: Acyl-CoA: diacylglycerol acyltransferase (DGAT) is a microsomal enzyme that plays a central role in the metabolism of cellular diacylglycerol lipids and catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol (DAG) and fatty acyl CoA as substrates. DGAT had been considered necessary for adipose tissue formation and essential for survival. There are two isozymes of DGAT encoded by the genes DGAT1 and DGAT2. DGAT1 is a host factor for HCV infection that binds core protein, localizes it to DGAT1-generated lipid droplets, and recruits viral RNA replication complexes for viral assembly. DGAT2-generated lipid droplets formed normally in cells treated with the DGAT1 inhibitor, suggesting that DGAT1 inhibitors may be useful as antiviral therapeutics.
References
1. Cases, S., Smith, S. J., Zheng, Y.-W., Myers, H. M., Lear, S. R., Sande, E., Novak, S., Collins, C., Welch, C. B., Lusis, A. J., Erickson, S. K., Farese, R. V., Jr. Identification of a gene encoding an acyl CoA:diacylglycerol acyltransferase, a key enzyme in triacylglycerol synthesis. Proc. Nat. Acad. Sci. 95: 13018-13023, 1998. 2. Cheng D, Iqbal J, Devenny J, Chu CH, Chen L, Dong J, Seethala R, Keim WJ, Azzara AV, Lawrence RM, Pelleymounter MA, Hussain MM (October 2008)."Acylation of acylglycerols by acyl coenzyme A:diacylglycerol acyltransferase 1 (DGAT1). Functional importance of DGAT1 in the intestinal fat absorption". J. Biol. Chem. 283 (44): 29802-11. 3. Herker, E., Harris, C., Hernandez, C., Carpentier, A., Kaehlcke, K., Rosenberg, A. R., Farese, R. V., Jr., Ott, M. Efficient hepatitis C virus particle formation requires diacylglycerol acyltransferase-1. Nature Med. 16: 1295-1298, 2010.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
55,278 Da
NCBI Official Full Name
diacylglycerol O-acyltransferase 1
NCBI Official Synonym Full Names
diacylglycerol O-acyltransferase 1
NCBI Official Symbol
DGAT1
NCBI Official Synonym Symbols
ARAT; DGAT; ARGP1; DIAR7
NCBI Protein Information
diacylglycerol O-acyltransferase 1
UniProt Protein Name
Diacylglycerol O-acyltransferase 1
UniProt Gene Name
DGAT1
UniProt Synonym Gene Names
AGRP1; DGAT; ARAT; Retinol O-fatty-acyltransferase
UniProt Entry Name
DGAT1_HUMAN

NCBI Description

This gene encodes an multipass transmembrane protein that functions as a key metabolic enzyme. The encoded protein catalyzes the conversion of diacylglycerol and fatty acyl CoA to triacylglycerol. This enzyme can also transfer acyl CoA to retinol. Activity of this protein may be associated with obesity and other metabolic diseases. [provided by RefSeq, Jul 2013]

Uniprot Description

DGAT1: Catalyzes the terminal and only committed step in triacylglycerol synthesis by using diacylglycerol and fatty acyl CoA as substrates. In contrast to DGAT2 it is not essential for survival. May be involved in VLDL (very low density lipoprotein) assembly. In liver, plays a role in esterifying exogenous fatty acids to glycerol. Functions as the major acyl-CoA retinol acyltransferase (ARAT) in the skin, where it acts to maintain retinoid homeostasis and prevent retinoid toxicity leading to skin and hair disorders. Belongs to the membrane-bound acyltransferase family. Sterol o-acyltransferase subfamily.

Protein type: EC 2.3.1.20; EC 2.3.1.76; Membrane protein, integral; Transferase; Membrane protein, multi-pass; Lipid Metabolism - glycerolipid; Cofactor and Vitamin Metabolism - retinol

Chromosomal Location of Human Ortholog: 8q24.3

Cellular Component: endoplasmic reticulum membrane; integral to membrane

Molecular Function: 2-acylglycerol O-acyltransferase activity; diacylglycerol O-acyltransferase activity; protein binding; retinol O-fatty-acyltransferase activity; transferase activity, transferring acyl groups

Biological Process: diacylglycerol metabolic process; fatty acid homeostasis; retinol metabolic process; sequestering of lipid; triacylglycerol biosynthetic process; triacylglycerol metabolic process

Disease: Diarrhea 7

Research Articles on DGAT1

Similar Products

Product Notes

The DGAT1 dgat1 (Catalog #AAA178380) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-DGAT1 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DGAT1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the DGAT1 dgat1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DGAT1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.