Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DEK Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Rabbit DEK Polyclonal Antibody | anti-DEK antibody

DEK antibody - N-terminal region

Gene Names
DEK; D6S231E
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Applications
Western Blot
Purity
Protein A purified
Synonyms
DEK; Polyclonal Antibody; DEK antibody - N-terminal region; anti-DEK antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: AAEGEGTPTQPASEKEPEMPGPREESEEEEDEDDEEEEEEEKEKSLIVEG
Sequence Length
375
Applicable Applications for anti-DEK antibody
Western Blot (WB)
Homology
Cow: 78%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Rabbit: 85%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DEK
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DEK Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-DEK Antibody Titration: 1.25ug/mlELISA Titer: 1:62500Positive Control: Jurkat cell lysate)
Related Product Information for anti-DEK antibody
This is a rabbit polyclonal antibody against DEK. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DEK was first identified in a fusion with the CAN nucleoporin protein in a specific subtype of acute myelogenous leukemia. DEK has also been shown to be an autoantigen in patients with pauciarticular onset juvenile rheumatoid arthritis. Further, the last 65 amino acids of DEK can partially reverse the mutation-prone phenotype of cells from patients with ataxia-telangiectasia

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43kDa
NCBI Official Full Name
protein DEK isoform 1
NCBI Official Synonym Full Names
DEK proto-oncogene
NCBI Official Symbol
DEK
NCBI Official Synonym Symbols
D6S231E
NCBI Protein Information
protein DEK
UniProt Protein Name
Protein DEK
Protein Family
UniProt Gene Name
DEK
UniProt Entry Name
DEK_HUMAN

NCBI Description

This gene encodes a protein with one SAP domain. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA, and is also involved in splice site selection during mRNA processing. Chromosomal aberrations involving this region, increased expression of this gene, and the presence of antibodies against this protein are all associated with various diseases. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

DEK: a ubiquitous protein with a SAP domain, which is found in a variety of nuclear proteins involved in transcription, DNA repair, RNA processing or apoptotic chromatin degradation. This protein binds to cruciform and superhelical DNA and induces positive supercoils into closed circular DNA and is also involved in splice site selection during mRNA processing. A chromosomal aberration involving DEK is found in a subset of acute myeloid leukemias (AML).

Protein type: Histone-binding; Oncoprotein; DNA-binding; DNA replication; RNA splicing

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: contractile fiber; nucleoplasm; nucleus

Molecular Function: DNA binding; histone binding

Biological Process: chromatin modification; positive regulation of gene expression, epigenetic; regulation of transcription from RNA polymerase II promoter; signal transduction; transcription from RNA polymerase II promoter; viral genome replication

Research Articles on DEK

Similar Products

Product Notes

The DEK dek (Catalog #AAA3224555) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEK antibody - N-terminal region reacts with Cow, Guinea Pig, Horse, Human, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's DEK can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DEK dek for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AAEGEGTPTQ PASEKEPEMP GPREESEEEE DEDDEEEEEE EKEKSLIVEG. It is sometimes possible for the material contained within the vial of "DEK, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.