Western Blot (WB)
(WB Suggested Anti-DEFB4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Rabbit anti-Human DEFB4A Polyclonal Antibody | anti-DEFB4A antibody
DEFB4A antibody - N-terminal region
Gene Names
DEFB4A; BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DEFB4A; Polyclonal Antibody; DEFB4A antibody - N-terminal region; anti-DEFB4A antibody
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGL
Sequence Length
64
Applicable Applications for anti-DEFB4A antibody
Western Blot (WB)
Homology
Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human DEFB4A
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DEFB4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Western Blot (WB)
(WB Suggested Anti-DEFB4A Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Human Placenta)
Related Product Information for anti-DEFB4A antibody
This is a rabbit polyclonal antibody against DEFB4A. It was validated on Western Blot
Target Description: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. DEFB4A is locally regulated by inflammation.
Target Description: Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. DEFB4A is locally regulated by inflammation.
Product Categories/Family for anti-DEFB4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
4kDa
NCBI Official Full Name
beta-defensin 4A
NCBI Official Synonym Full Names
defensin beta 4A
NCBI Official Symbol
DEFB4A
NCBI Official Synonym Symbols
BD-2; SAP1; DEFB2; DEFB4; HBD-2; DEFB-2; DEFB102
NCBI Protein Information
beta-defensin 4A
UniProt Protein Name
Beta-defensin 4A
Protein Family
UniProt Gene Name
DEFB4A
UniProt Synonym Gene Names
DEFB102; DEFB2; DEFB4; BD-2; hBD-2; SAP1
UniProt Entry Name
DFB4A_HUMAN
NCBI Description
Defensins form a family of microbicidal and cytotoxic peptides made by neutrophils. Members of the defensin family are highly similar in protein sequence. This gene encodes defensin, beta 4, an antibiotic peptide which is locally regulated by inflammation. [provided by RefSeq, Jul 2008]
Uniprot Description
defensin, beta 2: Has antibacterial activity (Potential). Belongs to the beta-defensin family. LAP/TAP subfamily.
Protein type: Secreted, signal peptide; Secreted; Motility/polarity/chemotaxis
Chromosomal Location of Human Ortholog: 8p23.1
Cellular Component: Golgi lumen; extracellular region
Biological Process: G-protein coupled receptor protein signaling pathway; defense response to bacterium; innate immune response; immune response; chemotaxis
Research Articles on DEFB4A
Similar Products
Product Notes
The DEFB4A defb4a (Catalog #AAA3214692) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DEFB4A antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DEFB4A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DEFB4A defb4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLFSFLFIFL MPLPGVFGGI GDPVTCLKSG AICHPVFCPR RYKQIGTCGL. It is sometimes possible for the material contained within the vial of "DEFB4A, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
