Western Blot (WB)
(WB Suggested Anti-DDX55 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Rabbit DDX55 Polyclonal Antibody | anti-DDX55 antibody
DDX55 antibody - C-terminal region
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Protein A purified
Synonyms
DDX55; Polyclonal Antibody; DDX55 antibody - C-terminal region; anti-DDX55 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GKQFPDFVPVDVNTDTIPFKDKIREKQRQKLLEQQRREKTENEGRRKFIK
Sequence Length
600
Applicable Applications for anti-DDX55 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 92%; Rat: 100%; Zebrafish: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DDX55
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DDX55 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Western Blot (WB)
(WB Suggested Anti-DDX55 Antibody Titration: 1.25ug/mlELISA Titer: 1:1562500Positive Control: Jurkat cell lysate)
Related Product Information for anti-DDX55 antibody
This is a rabbit polyclonal antibody against DDX55. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: Anti-DDX55 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for Anti-DDX55, but the biological validity of only one transcript has been confirmed.
Target Description: Anti-DDX55 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. Multiple alternatively spliced transcript variants have been found for Anti-DDX55, but the biological validity of only one transcript has been confirmed.
Product Categories/Family for anti-DDX55 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
66kDa
NCBI Official Full Name
ATP-dependent RNA helicase DDX55
NCBI Official Synonym Full Names
DEAD-box helicase 55
NCBI Official Symbol
DDX55
NCBI Protein Information
ATP-dependent RNA helicase DDX55
UniProt Protein Name
ATP-dependent RNA helicase DDX55
Protein Family
UniProt Gene Name
DDX55
UniProt Synonym Gene Names
KIAA1595
UniProt Entry Name
DDX55_HUMAN
NCBI Description
This gene encodes a member of protein family containing a characteristic Asp-Glu-Ala-Asp (DEAD) motif. These proteins are putative RNA helicases, and may be involved in a range of nuclear processes including translational initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Multiple alternatively spliced transcript variants have been found for this gene. Pseudogenes have been identified on chromosomes 1 and 12. [provided by RefSeq, Feb 2016]
Uniprot Description
DDX55: Probable ATP-binding RNA helicase. Belongs to the DEAD box helicase family. DDX55/SPB4 subfamily.
Protein type: Helicase; RNA-binding; EC 3.6.4.13
Chromosomal Location of Human Ortholog: 12q24.31
Cellular Component: membrane
Molecular Function: helicase activity; ATP binding
Biological Process: metabolic process
Similar Products
Product Notes
The DDX55 ddx55 (Catalog #AAA3203153) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX55 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DDX55 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DDX55 ddx55 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GKQFPDFVPV DVNTDTIPFK DKIREKQRQK LLEQQRREKT ENEGRRKFIK. It is sometimes possible for the material contained within the vial of "DDX55, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
