Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western blot-DDX31 Polyclonal Antibody)

Rabbit anti-Human DDX31 Polyclonal Antibody | anti-DDX31 antibody

DDX31 Polyclonal Antibody

Gene Names
DDX31; PPP1R25
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purification
Synonyms
DDX31; Polyclonal Antibody; DDX31 Polyclonal Antibody; PPP1R25; DEAD-box helicase 31; anti-DDX31 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Purity/Purification
Affinity Purification
Form/Format
PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Concentration
2.73 mg/ml (varies by lot)
Sequence Length
778
Applicable Applications for anti-DDX31 antibody
Western Blot (WB)
Application Notes
WB: 1:500-1:2000
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 652-851 of human DDX31 (NP_073616.6).
Immunogen Sequence
EIKMEDILCVLTRDDCFKGKRWGAQKSHAVGPQEIRERATVLQTVFEDYVHSSERRVSWAKKALQSFIQAYATYPRELKHIFHVRSLHLGHVAKSFGLRDAPRNLSALTRKKRKAHVKRPDLHKKTQSKHSLAEILRSEYSSGMEADIAKVKKQNAPGEPGGRPLQHSLQPTPCFGRGKTLKWRKTQKGVQRDSKTSQKV
Positive Samples
A-549
Cellular Location
Nucleus, Nucleolus
Preparation and Storage
Store at -20 degree C. Avoid freeze/thaw cycles.

Western Blot (WB)

(Western blot-DDX31 Polyclonal Antibody)

Western Blot (WB) (Western blot-DDX31 Polyclonal Antibody)
Related Product Information for anti-DDX31 antibody
DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
Calculated: 34kDa; 64kDa; 85kDa; 94kDa
Observed: 94kDa
NCBI Official Full Name
probable ATP-dependent RNA helicase DDX31 isoform 3
NCBI Official Synonym Full Names
DEAD-box helicase 31
NCBI Official Symbol
DDX31
NCBI Official Synonym Symbols
PPP1R25
NCBI Protein Information
probable ATP-dependent RNA helicase DDX31
UniProt Protein Name
Probable ATP-dependent RNA helicase DDX31
UniProt Gene Name
DDX31

NCBI Description

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this DEAD box protein family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a member of this family. The function of this member has not been determined. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Apr 2016]

Uniprot Description

DDX31: Probable ATP-dependent RNA helicase. Belongs to the DEAD box helicase family. DDX31/DBP7 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.6.4.13; Hydrolase; Nucleolus

Chromosomal Location of Human Ortholog: 9q34.13

Cellular Component: cytoplasm; Golgi apparatus; intracellular membrane-bound organelle; nucleolus

Molecular Function: ATP binding; ATP-dependent RNA helicase activity; protein binding; RNA binding

Biological Process: ribosome biogenesis; RNA secondary structure unwinding

Research Articles on DDX31

Similar Products

Product Notes

The DDX31 ddx31 (Catalog #AAA9140591) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DDX31 Polyclonal Antibody reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's DDX31 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). WB: 1:500-1:2000. Researchers should empirically determine the suitability of the DDX31 ddx31 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DDX31, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.