Western Blot (WB)
(WB Suggested Anti-DCTN3 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellDCTN3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Rabbit DCTN3 Polyclonal Antibody | anti-DCTN3 antibody
DCTN3 antibody - C-terminal region
Gene Names
ENTPD3; HB6; CD39L3; NTPDase-3
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DCTN3; Polyclonal Antibody; DCTN3 antibody - C-terminal region; anti-DCTN3 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ARLQRLAQIHIQQQDQCVEITEESKALLEEYNKTTMLLSKQFVQWDELLC
Sequence Length
186
Applicable Applications for anti-DCTN3 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%; Zebrafish: 79%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-DCTN3 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellDCTN3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Western Blot (WB)
(WB Suggested Anti-DCTN3 AntibodyTitration: 1.0 ug/mlPositive Control: 293T Whole CellDCTN3 is supported by BioGPS gene expression data to be expressed in HEK293T)
Related Product Information for anti-DCTN3 antibody
This is a rabbit polyclonal antibody against DCTN3. It was validated on Western Blot
Target Description: This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing of this gene generates 2 transcript variants.
Target Description: This gene encodes the smallest subunit of dynactin, a macromolecular complex consisting of 10 subunits ranging in size from 22 to 150 kD. Dynactin binds to both microtubules and cytoplasmic dynein. It is involved in a diverse array of cellular functions, including ER-to-Golgi transport, the centripetal movement of lysosomes and endosomes, spindle formation, cytokinesis, chromosome movement, nuclear positioning, and axonogenesis. This subunit, like most other dynactin subunits, exists only as a part of the dynactin complex. It is primarily an alpha-helical protein with very little coiled coil, and binds directly to the largest subunit (p150) of dynactin. Alternative splicing of this gene generates 2 transcript variants.
Product Categories/Family for anti-DCTN3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
20kDa
NCBI Official Full Name
ectonucleoside triphosphate diphosphohydrolase 3 isoform 1
NCBI Official Synonym Full Names
ectonucleoside triphosphate diphosphohydrolase 3
NCBI Official Symbol
ENTPD3
NCBI Official Synonym Symbols
HB6; CD39L3; NTPDase-3
NCBI Protein Information
ectonucleoside triphosphate diphosphohydrolase 3
UniProt Protein Name
Ectonucleoside triphosphate diphosphohydrolase 3
Protein Family
UniProt Gene Name
ENTPD3
UniProt Synonym Gene Names
CD39L3; NTPDase 3; Ecto-ATPDase 3; Ecto-ATPase 3
UniProt Entry Name
ENTP3_HUMAN
NCBI Description
This gene encodes a plasma membrane-bound divalent cation-dependent E-type nucleotidase. The encoded protein is involved in the regulation of extracellular levels of ATP by hydrolysis of it and other nucleotides. Multiple transcript variants have been described. [provided by RefSeq, May 2014]
Uniprot Description
ENTPD3: Has a threefold preference for the hydrolysis of ATP over ADP. Belongs to the GDA1/CD39 NTPase family.
Protein type: EC 3.6.1.5; Hydrolase; Membrane protein, integral; Membrane protein, multi-pass; Nucleotide Metabolism - purine; Nucleotide Metabolism - pyrimidine; Phosphatase (non-protein)
Chromosomal Location of Human Ortholog: 3p21.3
Molecular Function: protein binding
Research Articles on DCTN3
Similar Products
Product Notes
The DCTN3 entpd3 (Catalog #AAA3215629) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCTN3 antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's DCTN3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCTN3 entpd3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ARLQRLAQIH IQQQDQCVEI TEESKALLEE YNKTTMLLSK QFVQWDELLC. It is sometimes possible for the material contained within the vial of "DCTN3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
