Western Blot (WB)
(Host: RabbitTarget Name: DCDC2BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit anti-Cow, Human DCDC2B Polyclonal Antibody | anti-DCDC2B antibody
DCDC2B Antibody - C-terminal region
Reactivity
Cow, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DCDC2B; Polyclonal Antibody; DCDC2B Antibody - C-terminal region; anti-DCDC2B antibody
Host
Rabbit
Reactivity
Cow, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: ELLVPSPSLPRGCWQPPGSKSRPHRQGAQGHRAQVTQPSPKEPDRIKPSA
Sequence Length
349
Applicable Applications for anti-DCDC2B antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human DCDC2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DCDC2BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DCDC2BSample Type: HepG2 Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DCDC2B antibody
This is a rabbit polyclonal antibody against DCDC2B. It was validated on Western Blot
Target Description: This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization.
Target Description: This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization.
Product Categories/Family for anti-DCDC2B antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37kDa
NCBI Official Full Name
doublecortin domain-containing protein 2B
NCBI Official Synonym Full Names
doublecortin domain containing 2B
NCBI Official Symbol
DCDC2B
NCBI Protein Information
doublecortin domain-containing protein 2B
UniProt Protein Name
Doublecortin domain-containing protein 2B
Protein Family
UniProt Gene Name
DCDC2B
UniProt Entry Name
DCD2B_HUMAN
NCBI Description
This gene encodes a member of the doublecortin family. The protein encoded by this gene contains two doublecortin domains. The doublecortin domain has been demonstrated to bind tubulin and enhance microtubule polymerization. [provided by RefSeq, Sep 2010]
Similar Products
Product Notes
The DCDC2B dcdc2b (Catalog #AAA3218386) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCDC2B Antibody - C-terminal region reacts with Cow, Human and may cross-react with other species as described in the data sheet. AAA Biotech's DCDC2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCDC2B dcdc2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: ELLVPSPSLP RGCWQPPGSK SRPHRQGAQG HRAQVTQPSP KEPDRIKPSA. It is sometimes possible for the material contained within the vial of "DCDC2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
