Western Blot (WB)
(Host: RabbitTarget Name: DCAF12L2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Rabbit DCAF12L2 Polyclonal Antibody | anti-DCAF12L2 antibody
DCAF12L2 Antibody - N-terminal region
Gene Names
DCAF12L2; WDR40C
Reactivity
Dog, Human, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DCAF12L2; Polyclonal Antibody; DCAF12L2 Antibody - N-terminal region; anti-DCAF12L2 antibody
Host
Rabbit
Reactivity
Dog, Human, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KAPAVEAGAGSSSSQGLAAADGEGPLLPKKQKRPATRRRLVHYLKGREVG
Sequence Length
463
Applicable Applications for anti-DCAF12L2 antibody
Western Blot (WB)
Homology
Dog: 79%; Human: 100%; Pig: 85%; Rabbit: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human DCAF12L2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: DCAF12L2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: DCAF12L2Sample Type: Jurkat Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-DCAF12L2 antibody
This is a rabbit polyclonal antibody against DCAF12L2. It was validated on Western Blot
Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein.
Target Description: This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein.
Product Categories/Family for anti-DCAF12L2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
51kDa
NCBI Official Full Name
DDB1- and CUL4-associated factor 12-like protein 2
NCBI Official Synonym Full Names
DDB1 and CUL4 associated factor 12 like 2
NCBI Official Symbol
DCAF12L2
NCBI Official Synonym Symbols
WDR40C
NCBI Protein Information
DDB1- and CUL4-associated factor 12-like protein 2
UniProt Protein Name
DDB1- and CUL4-associated factor 12-like protein 2
Protein Family
UniProt Gene Name
DCAF12L2
UniProt Synonym Gene Names
WDR40C
UniProt Entry Name
DC122_HUMAN
NCBI Description
This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by Gly-His and Trp-Asp (GH-WD), which may facilitate formation of heterotrimeric or multi-protein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This gene appears to represent an intronless retrocopy of a related multi-exon gene located on chromosome 9. However, the CDS of this intronless gene remains intact, it is conserved in other mammalian species, it is known to be transcribed, and it is therefore thought to encode a functional protein. [provided by RefSeq, May 2010]
Research Articles on DCAF12L2
Similar Products
Product Notes
The DCAF12L2 dcaf12l2 (Catalog #AAA3217776) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DCAF12L2 Antibody - N-terminal region reacts with Dog, Human, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's DCAF12L2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DCAF12L2 dcaf12l2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KAPAVEAGAG SSSSQGLAAA DGEGPLLPKK QKRPATRRRL VHYLKGREVG. It is sometimes possible for the material contained within the vial of "DCAF12L2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
