Western Blot (WB)
(Western Blot analysis of ETV7 expression in transfected 293T cell line by ETV7 polyclonal antibody. Lane 1: ETV7 transfected lysate (37.51kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human ETV7 Polyclonal Antibody
ETV7 (Transcription Factor ETV7, ETS Translocation Variant 7, ETS-related Protein Tel2, Tel-related Ets Factor, Transcription Factor Tel-2, TEL2, TELB, TREF)
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
ETV7; Polyclonal Antibody; ETV7 (Transcription Factor ETV7; ETS Translocation Variant 7; ETS-related Protein Tel2; Tel-related Ets Factor; Transcription Factor Tel-2; TEL2; TELB; TREF); Anti -ETV7 (Transcription Factor ETV7; anti-ETV7 antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ETV7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MQEGELAISPISPVAAMPPLGTHVQARCEAQINLLGEGGICKLPGRLRIQPALWSREDVLHWLRWAEQEYSLPCTAEHGFEMNGRALCILTKDDFRHRAPSSGDVLYELLQYIKTQRRALVCGPFFGGIFRLKTPTQHSPVPPEEVTGPSQMDTRRGHLLQPPDPGLTSNFGHLDDPGLARWTPGKEESLNLCHCAELGCRTQGVCSFPAMPQAPIDGRIADCRLLWDYVYQLLLDTRYEPYIKWEDKDAKIFRVVDPNGLARLWGNHKNRVNMTYEKMSRALRHYYKLNIIKKEPGQKLLFRFLKTPGKMVQDKHSHLEPLESQEQDRIEFKDKRPEISP
Applicable Applications for anti-ETV7 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human ETV7, aa1-341 (NP_057219.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of ETV7 expression in transfected 293T cell line by ETV7 polyclonal antibody. Lane 1: ETV7 transfected lysate (37.51kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of ETV7 expression in transfected 293T cell line by ETV7 polyclonal antibody. Lane 1: ETV7 transfected lysate (37.51kD). Lane 2: Non-transfected lysate.)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ETV7 on Daoy cell. [antibody concentration 10ug/ml].)
Immunofluorescence (IF)
(Immunofluorescence of purified antibody to ETV7 on Daoy cell. [antibody concentration 10ug/ml].)
Related Product Information for anti-ETV7 antibody
Transcriptional repressor; binds to the DNA sequence 5'-CCGGAAGT-3'. Isoform A does not seem to have a repressor activity. Isoform C does not seem to have a repressor activity.
Product Categories/Family for anti-ETV7 antibody
Similar Products
Product Notes
The ETV7 (Catalog #AAA6010298) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ETV7 (Transcription Factor ETV7, ETS Translocation Variant 7, ETS-related Protein Tel2, Tel-related Ets Factor, Transcription Factor Tel-2, TEL2, TELB, TREF) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ETV7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the ETV7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MQEGELAISP ISPVAAMPPL GTHVQARCEA QINLLGEGGI CKLPGRLRIQ PALWSREDVL HWLRWAEQEY SLPCTAEHGF EMNGRALCIL TKDDFRHRAP SSGDVLYELL QYIKTQRRAL VCGPFFGGIF RLKTPTQHSP VPPEEVTGPS QMDTRRGHLL QPPDPGLTSN FGHLDDPGLA RWTPGKEESL NLCHCAELGC RTQGVCSFPA MPQAPIDGRI ADCRLLWDYV YQLLLDTRYE PYIKWEDKDA KIFRVVDPNG LARLWGNHKN RVNMTYEKMS RALRHYYKLN IIKKEPGQKL LFRFLKTPGK MVQDKHSHLE PLESQEQDRI EFKDKRPEIS P. It is sometimes possible for the material contained within the vial of "ETV7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
