Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-DAZL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysate)

Rabbit DAZL Polyclonal Antibody | anti-DAZL antibody

DAZL antibody - C-terminal region

Gene Names
DAZL; DAZH; DAZL1; DAZLA; SPGYLA
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Applications
Western Blot
Purity
Affinity Purified
Synonyms
DAZL; Polyclonal Antibody; DAZL antibody - C-terminal region; anti-DAZL antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EVDPGAEVVPNECSVHEATPPSGNGPQKKSVDRSIQTVVSCLFNPENRLR
Sequence Length
295
Applicable Applications for anti-DAZL antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 93%; Goat: 93%; Guinea Pig: 86%; Horse: 92%; Human: 100%; Mouse: 93%; Rat: 86%; Sheep: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human DAZL
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-DAZL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysate)

Western Blot (WB) (WB Suggested Anti-DAZL Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: 721_B cell lysate)
Related Product Information for anti-DAZL antibody
This is a rabbit polyclonal antibody against DAZL. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: DAZ (Deleted in AZoospermia) is the potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. DAZL is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of the autosomal gene encoding DAZL during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in the Dazl gene have been linked to severe spermatogenic failure and infertility in males.The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
deleted in azoospermia-like isoform 2
NCBI Official Synonym Full Names
deleted in azoospermia like
NCBI Official Symbol
DAZL
NCBI Official Synonym Symbols
DAZH; DAZL1; DAZLA; SPGYLA
NCBI Protein Information
deleted in azoospermia-like
UniProt Protein Name
Deleted in azoospermia-like
Protein Family
UniProt Gene Name
DAZL
UniProt Synonym Gene Names
DAZH; DAZL1; DAZLA; SPGYLA
UniProt Entry Name
DAZL_HUMAN

NCBI Description

The DAZ (Deleted in AZoospermia) gene family encodes potential RNA binding proteins that are expressed in prenatal and postnatal germ cells of males and females. The protein encoded by this gene is localized to the nucleus and cytoplasm of fetal germ cells and to the cytoplasm of developing oocytes. In the testis, this protein is localized to the nucleus of spermatogonia but relocates to the cytoplasm during meiosis where it persists in spermatids and spermatozoa. Transposition and amplification of this autosomal gene during primate evolution gave rise to the DAZ gene cluster on the Y chromosome. Mutations in this gene have been linked to severe spermatogenic failure and infertility in males. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jun 2010]

Uniprot Description

DAZL: RNA-binding protein, which is essential for gametogenesis. Plays a central role during spermatogenesis. May act by binding to the 3'-UTR of mRNA and thereby regulating the translation of key transcripts. Homodimer and heterodimer. Forms a heterodimer with DAZ. Interacts with BOLL, DAZAP1 and DAZAP2. Interacts with PUM2. Testis specific. Belongs to the RRM DAZ family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Translation

Chromosomal Location of Human Ortholog: 3p24.3

Cellular Component: polysome; cytoplasm; nucleus

Molecular Function: identical protein binding; protein binding; translation activator activity; mRNA 3'-UTR binding; RNA binding; nucleotide binding

Biological Process: positive regulation of translational initiation; positive regulation of meiosis; female meiosis II; multicellular organismal development; spermatogenesis; oocyte maturation; germ cell development

Research Articles on DAZL

Similar Products

Product Notes

The DAZL dazl (Catalog #AAA3205169) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DAZL antibody - C-terminal region reacts with Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's DAZL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the DAZL dazl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVDPGAEVVP NECSVHEATP PSGNGPQKKS VDRSIQTVVS CLFNPENRLR. It is sometimes possible for the material contained within the vial of "DAZL, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.