Rabbit anti-Human, Mouse DARC Polyclonal Antibody | anti-DARC antibody

DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax Receptor, CD234, FY, GPD) APC

Cat. Num. AAA6375634

• Gene Names: ACKR1; FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1
• Reactivity: Human, Mouse
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: DARC; Polyclonal Antibody; DARC (Duffy Antigen/Chemokine Receptor; Fy Glycoprotein; GpFy; Glycoprotein D; Plasmodium Vivax Receptor; CD234; FY; GPD) APC; anti-DARC antibody

• Host: Rabbit
• Reactivity: Human, Mouse
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human DARC. Species Crossreactivity: mouse.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).

• Applicable Applications for anti-DARC antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human DARC, aa1-336 (NP_002027.2).
• Immunogen Sequence: MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
• Conjugate: APC
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DARC expression in transfected 293T cell line by DARC polyclonal antibody. Lane 1: DARC transfected lysate (35.6kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-DARC antibody

DARC, also known as the Duffy antigen/chemokine receptor, is a seven-transmembrane protein homologous to the classical chemokine G-protein coupled receptors (GPCRs) with the exception of the motif required for G protein coupling. DARC can bind with high affinity several chemokines without transducing any signal, suggesting it may modulate the signals normally induced by these chemokines. Recently, DARC was found to interact with KAI1, a four transmembrane protein recently identified as a tumor metastasis suppressor protein. It is thought that tumor cells dislodged from the primary tumor and expressing KAI1 interact with DARC proteins expressed on vascular cells, transmitting a senescent signal to the tumor cells, while tumor cells that have lost KAI1 expression can proliferate and potentially give rise to metastases. At least three isoforms of DARC are known to exist.

Product Categories/Family for anti-DARC antibody

Antibodies; Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 42822887
• NCBI GeneID: 2532
• NCBI Accession #: NP_002027.2
• NCBI GenBank Nucleotide #: NM_002036
• UniProt Accession #: Q16570; O75898; Q16300; Q8WWE3; Q9UJP0; Q9UKZ5; Q9UKZ6; Q9UQE1; A8YPG5
• Molecular Weight: 35,678 Da
• NCBI Official Full Name: atypical chemokine receptor 1 isoform b
• NCBI Official Synonym Full Names: atypical chemokine receptor 1 (Duffy blood group)
• NCBI Official Symbol: ACKR1
• NCBI Official Synonym Symbols: FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1
• NCBI Protein Information: atypical chemokine receptor 1; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; Duffy blood group, chemokine receptor; Duffy blood group, atypical chemokine receptor
• UniProt Protein Name: Duffy antigen/chemokine receptor
• Protein Family: Darcynin
• UniProt Gene Name: DARC
• UniProt Synonym Gene Names: FY; GPD; GpFy
• UniProt Entry Name: DUFFY_HUMAN

NCBI Description

The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DARC: Non-specific receptor for many chemokines such as IL-8, GRO, RANTES, MCP-1 and TARC. It is also the receptor for the human malaria parasites Plasmodium vivax and Plasmodium knowlesi. Belongs to the G-protein coupled receptor Duffy family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, Duffy family; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: recycling endosome; early endosome; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; transmembrane receptor activity; C-C chemokine binding; receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; defense response; inflammatory response; regulation of chemokine production

Disease: White Blood Cell Count Quantitative Trait Locus 1; Blood Group, Duffy System; Malaria, Susceptibility To