Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of DARC expression in transfected 293T cell line by DARC polyclonal antibody. Lane 1: DARC transfected lysate (35.6kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human, Mouse DARC Polyclonal Antibody | anti-DARC antibody

DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax Receptor, CD234, FY, GPD) (AP)

Gene Names
ACKR1; FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1
Reactivity
Human, Mouse
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
DARC; Polyclonal Antibody; DARC (Duffy Antigen/Chemokine Receptor; Fy Glycoprotein; GpFy; Glycoprotein D; Plasmodium Vivax Receptor; CD234; FY; GPD) (AP); anti-DARC antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Mouse
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human DARC. Species Crossreactivity: mouse.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-DARC antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human DARC, aa1-336 (NP_002027.2).
Immunogen Sequence
MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of DARC expression in transfected 293T cell line by DARC polyclonal antibody. Lane 1: DARC transfected lysate (35.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of DARC expression in transfected 293T cell line by DARC polyclonal antibody. Lane 1: DARC transfected lysate (35.6kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-DARC antibody
DARC, also known as the Duffy antigen/chemokine receptor, is a seven-transmembrane protein homologous to the classical chemokine G-protein coupled receptors (GPCRs) with the exception of the motif required for G protein coupling. DARC can bind with high affinity several chemokines without transducing any signal, suggesting it may modulate the signals normally induced by these chemokines. Recently, DARC was found to interact with KAI1, a four transmembrane protein recently identified as a tumor metastasis suppressor protein. It is thought that tumor cells dislodged from the primary tumor and expressing KAI1 interact with DARC proteins expressed on vascular cells, transmitting a senescent signal to the tumor cells, while tumor cells that have lost KAI1 expression can proliferate and potentially give rise to metastases. At least three isoforms of DARC are known to exist.
Product Categories/Family for anti-DARC antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
35,678 Da
NCBI Official Full Name
atypical chemokine receptor 1 isoform b
NCBI Official Synonym Full Names
atypical chemokine receptor 1 (Duffy blood group)
NCBI Official Symbol
ACKR1
NCBI Official Synonym Symbols
FY; Dfy; GPD; DARC; GpFy; CCBP1; CD234; WBCQ1
NCBI Protein Information
atypical chemokine receptor 1; glycoprotein D; Fy glycoprotein; Duffy blood group antigen; plasmodium vivax receptor; Duffy blood group, chemokine receptor; Duffy blood group, atypical chemokine receptor
UniProt Protein Name
Duffy antigen/chemokine receptor
Protein Family
UniProt Gene Name
DARC
UniProt Synonym Gene Names
FY; GPD; GpFy
UniProt Entry Name
DUFFY_HUMAN

NCBI Description

The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

DARC: Non-specific receptor for many chemokines such as IL-8, GRO, RANTES, MCP-1 and TARC. It is also the receptor for the human malaria parasites Plasmodium vivax and Plasmodium knowlesi. Belongs to the G-protein coupled receptor Duffy family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: GPCR, Duffy family; Receptor, GPCR; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 1q21-q22

Cellular Component: recycling endosome; early endosome; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; transmembrane receptor activity; C-C chemokine binding; receptor activity

Biological Process: G-protein coupled receptor protein signaling pathway; defense response; inflammatory response; regulation of chemokine production

Disease: White Blood Cell Count Quantitative Trait Locus 1; Blood Group, Duffy System; Malaria, Susceptibility To

Research Articles on DARC

Similar Products

Product Notes

The DARC darc (Catalog #AAA6375633) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The DARC (Duffy Antigen/Chemokine Receptor, Fy Glycoprotein, GpFy, Glycoprotein D, Plasmodium Vivax Receptor, CD234, FY, GPD) (AP) reacts with Human, Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's DARC can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the DARC darc for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "DARC, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.