Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti- Cytokeratin 19 Picoband antibody, MBS178279, Western blottingAll lanes: Anti Cytokeratin 19 (MBS178279) at 0.5ug/mlLane 1: Human Placenta Tissue Lysate at 50ugLane 2: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 44KDObserved bind size: 44KD)

Cytokeratin 19 Polyclonal Antibody | anti-KRT19 antibody

Anti-Cytokeratin 19 Antibody

Gene Names
KRT19; K19; CK19; K1CS
Reactivity
Human, Mouse, Rat
Applications
Western Blot, Immunohistochemistry
Purity
Immunogen Affinity Purified
Synonyms
Cytokeratin 19; Polyclonal Antibody; Anti-Cytokeratin 19 Antibody; Keratin; 40 kDa keratin intermediate filament; CK 19; CK-19; ck19; Cytokeratin-19; k19; K1C19_HUMAN; k1cs; Keratin 19; Keratin type I 40 kD; Keratin type i 40kD; Keratin type I cytoskeletal 19; type I cytoskeletal 19; type I; 40 kd; Keratin-19; krt19; mgc15366; keratin 19; anti-KRT19 antibody
Ordering
For Research Use Only!
Reactivity
Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
400
Applicable Applications for anti-KRT19 antibody
Western Blot (WB), Immunohistochemistry (IHC) Paraffin
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti- Cytokeratin 19 Picoband antibody, MBS178279, Western blottingAll lanes: Anti Cytokeratin 19 (MBS178279) at 0.5ug/mlLane 1: Human Placenta Tissue Lysate at 50ugLane 2: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 44KDObserved bind size: 44KD)

Western Blot (WB) (Anti- Cytokeratin 19 Picoband antibody, MBS178279, Western blottingAll lanes: Anti Cytokeratin 19 (MBS178279) at 0.5ug/mlLane 1: Human Placenta Tissue Lysate at 50ugLane 2: MCF-7 Whole Cell Lysate at 40ugPredicted bind size: 44KDObserved bind size: 44KD)

Immunohistochemistry (IHC)

(Anti- Cytokeratin 19 Picoband antibody, MBS178279, IHC(P)IHC(P): Mouse Intestine Tissue)

Immunohistochemistry (IHC) (Anti- Cytokeratin 19 Picoband antibody, MBS178279, IHC(P)IHC(P): Mouse Intestine Tissue)

Immunohistochemistry (IHC)

(Anti- Cytokeratin 19 Picoband antibody, MBS178279, IHC(P)IHC(P): Rat Kidney Tissue)

Immunohistochemistry (IHC) (Anti- Cytokeratin 19 Picoband antibody, MBS178279, IHC(P)IHC(P): Rat Kidney Tissue)

Immunohistochemistry (IHC)

(Anti- Cytokeratin 19 Picoband antibody, MBS178279, IHC(P)IHC(P): Human Mammary Cancer Tissue)

Immunohistochemistry (IHC) (Anti- Cytokeratin 19 Picoband antibody, MBS178279, IHC(P)IHC(P): Human Mammary Cancer Tissue)
Related Product Information for anti-KRT19 antibody
Description: Rabbit IgG polyclonal antibody for Keratin, type I cytoskeletal 19(KRT19) detection. Tested with WB, IHC-P in Human;Mouse;Rat.

Background: Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
References
1. "Entrez Gene: KRT19 keratin 19". 2. Schweizer J, Bowden PE, Coulombe PA, Langbein L, Lane EB, Magin TM, Maltais L, Omary MB, Parry DA, Rogers MA, Wright MW (Jul 2006). "New consensus nomenclature for mammalian keratins". J Cell Biol 174 (2): 169-74. 3. W. Jeffrey Allard, Jeri Matera, M. Craig Miller, et al. (October 2004). "Tumor Cells Circulate in the Peripheral Blood of All Major Carcinomas but not in Healthy Subjects or Patients With Nonmalignant Diseases". Clin. Cancer Research 10 (20): 6897-6904.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44,106 Da
NCBI Official Full Name
keratin, type I cytoskeletal 19
NCBI Official Synonym Full Names
keratin 19
NCBI Official Symbol
KRT19
NCBI Official Synonym Symbols
K19; CK19; K1CS
NCBI Protein Information
keratin, type I cytoskeletal 19
UniProt Protein Name
Keratin, type I cytoskeletal 19
Protein Family
UniProt Gene Name
KRT19
UniProt Synonym Gene Names
CK-19; K19
UniProt Entry Name
K1C19_HUMAN

NCBI Description

The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. [provided by RefSeq, Jul 2008]

Uniprot Description

K19: a type I cytoskeletal keratin. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. Keratin 19 differs from all other IF proteins in lacking the C-terminal tail domain. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.

Protein type: Cytoskeletal

Chromosomal Location of Human Ortholog: 17q21.2

Cellular Component: costamere; dystrophin-associated glycoprotein complex; intermediate filament; plasma membrane; sarcolemma; Z disc

Molecular Function: protein binding; protein complex binding; structural constituent of cytoskeleton; structural constituent of muscle

Biological Process: Notch signaling pathway; response to estrogen stimulus; sarcomere organization; viral reproduction

Research Articles on KRT19

Similar Products

Product Notes

The KRT19 krt19 (Catalog #AAA178279) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-Cytokeratin 19 Antibody reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's Cytokeratin 19 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunohistochemistry (IHC) Paraffin. Western Blot Concentration: 0.1-0.5ug/ml Immunohistochemistry (IHC) Paraffin Concentration: 0.5-1ug/ml. Researchers should empirically determine the suitability of the KRT19 krt19 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytokeratin 19, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.