Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of CYCS expression in transfected 293T cell line by CYCS polyclonal antibody. Lane 1: CYCS transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human Cytochrome C Polyclonal Antibody | anti-CYCS antibody

Cytochrome C (CYCS, CYC) (FITC)

Gene Names
CYCS; CYC; HCS; THC4
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Cytochrome C; Polyclonal Antibody; Cytochrome C (CYCS; CYC) (FITC); anti-CYCS antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human CYCS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein Isothiocyanate (FITC).
Applicable Applications for anti-CYCS antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human CYCS, aa1-105 (NP_061820.1).
Immunogen Sequence
MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Conjugate
FITC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYCS expression in transfected 293T cell line by CYCS polyclonal antibody. Lane 1: CYCS transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of CYCS expression in transfected 293T cell line by CYCS polyclonal antibody. Lane 1: CYCS transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CYCS and CASP9 HeLa cells were stained with CYCS rabbit purified polyclonal 1:1200 and CASP9 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between CYCS and CASP9 HeLa cells were stained with CYCS rabbit purified polyclonal 1:1200 and CASP9 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-CYCS antibody
Cytochrome c is a 15kD protein found in the mitochondrial intermembrane space with a heme-binding domain. Cytochrome c is a component of the electron transport chain; the heme group transfers electrons from cytochrome b-c1 complex to cytochrome oxidase complex. Cytochrome c initiates apoptosis by release to cytoplasm and binding Apaf-1 which activates procaspase 9. Cytochrome c interacts with the cytochrome b-c1 complex, cytochrome oxidase complex, heme, Apaf-1, and Caspase 9 proteins.
Product Categories/Family for anti-CYCS antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11,749 Da
NCBI Official Full Name
cytochrome c
NCBI Official Synonym Full Names
cytochrome c, somatic
NCBI Official Symbol
CYCS
NCBI Official Synonym Symbols
CYC; HCS; THC4
NCBI Protein Information
cytochrome c
UniProt Protein Name
Cytochrome c
Protein Family
UniProt Gene Name
CYCS
UniProt Synonym Gene Names
CYC
UniProt Entry Name
CYC_HUMAN

NCBI Description

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]

Uniprot Description

CYCS: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Belongs to the cytochrome c family.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Oxidoreductase; Mitochondrial; Apoptosis

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: protein phosphatase type 2A complex; mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; nucleus; cytosol

Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; protein binding; iron ion binding; heme binding; protein serine/threonine phosphatase activity

Biological Process: mitochondrion organization and biogenesis; cellular metabolic process; response to reactive oxygen species; dephosphorylation; apoptosis; organelle organization and biogenesis; cellular respiration; mitochondrial electron transport, cytochrome c to oxygen; DNA fragmentation during apoptosis; caspase activation via cytochrome c; transmembrane transport; mitochondrial electron transport, ubiquinol to cytochrome c

Disease: Thrombocytopenia 4

Research Articles on CYCS

Similar Products

Product Notes

The CYCS cycs (Catalog #AAA6375614) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Cytochrome C (CYCS, CYC) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Cytochrome C can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CYCS cycs for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Cytochrome C, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.