Cytochrome c Recombinant Protein | CYCS recombinant protein

Recombinant Human Cytochrome c

Cat. Num. AAA963162

• Gene Names: CYCS; CYC; HCS; THC4
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Cytochrome c; Recombinant Human Cytochrome c; CYCS recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 2-105. Full-length of the mature protein.
• Sequence: GDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
• Sequence Length: 105

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CYCS recombinant protein

Electron carrier protein. The oxidized form of the cytochrome c he group can accept an electron from the he group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Plays a role in apoptosis. Suppression of the anti-apoptotic mbers or activation of the pro-apoptotic mbers of the Bcl-2 family leads to altered mitochondrial membrane permeability resulting in release of cytochrome c into the cytosol. Binding of cytochrome c to Apaf-1 triggers the activation of caspase-9, which then accelerates apoptosis by activating other caspases.

Product Categories/Family for CYCS recombinant protein

Apoptosis

References

The human somatic cytochrome c gene two classes of processed pseudogenes demarcate a period of rapid molecular evolution.Evans M.J., Scarpulla R.C.Proc. Natl. Acad. Sci. U.S.A. 85:9625-9629(1988)

NCBI and Uniprot Product Information

• NCBI GI #: 11128019
• NCBI GeneID: 54205
• NCBI Accession #: NP_061820.1
• NCBI GenBank Nucleotide #: NM_018947.5
• UniProt Accession #: P99999; P00001; Q6NUR2; Q6NX69; Q96BV4; A4D166; B2R4I1
• Molecular Weight: 38.6 kDa
• NCBI Official Full Name: cytochrome c
• NCBI Official Synonym Full Names: cytochrome c, somatic
• NCBI Official Symbol: CYCS
• NCBI Official Synonym Symbols: CYC; HCS; THC4
• NCBI Protein Information: cytochrome c
• UniProt Protein Name: Cytochrome c
• Protein Family: Cytochrome
• UniProt Gene Name: CYCS
• UniProt Synonym Gene Names: CYC
• UniProt Entry Name: CYC_HUMAN

NCBI Description

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]

Uniprot Description

CYCS: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Belongs to the cytochrome c family.

Protein type: Mitochondrial; Apoptosis; Protein phosphatase, Ser/Thr (non-receptor); Oxidoreductase

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: cytosol; mitochondrial inner membrane; mitochondrial intermembrane space; mitochondrion; nucleus; protein phosphatase type 2A complex

Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; heme binding; metal ion binding; protein binding; protein serine/threonine phosphatase activity

Biological Process: apoptosis; caspase activation via cytochrome c; cellular metabolic process; cellular respiration; gene expression; mitochondrial electron transport, cytochrome c to oxygen; mitochondrial electron transport, ubiquinol to cytochrome c; mitochondrion organization and biogenesis; organelle organization and biogenesis; programmed cell death; protein amino acid dephosphorylation; response to reactive oxygen species; transcription initiation from RNA polymerase II promoter

Disease: Thrombocytopenia 4