Rabbit anti-Human Cytochrome C Polyclonal Antibody | anti-CYCS antibody

Cytochrome C (CYCS, CYC) (Biotin)

Cat. Num. AAA6375613

• Gene Names: CYCS; CYC; HCS; THC4
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: Cytochrome C; Polyclonal Antibody; Cytochrome C (CYCS; CYC) (Biotin); anti-CYCS antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human CYCS.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-CYCS antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human CYCS, aa1-105 (NP_061820.1).
• Immunogen Sequence: MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of CYCS expression in transfected 293T cell line by CYCS polyclonal antibody. Lane 1: CYCS transfected lysate (11.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between CYCS and CASP9 HeLa cells were stained with CYCS rabbit purified polyclonal 1:1200 and CASP9 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-CYCS antibody

Cytochrome c is a 15kD protein found in the mitochondrial intermembrane space with a heme-binding domain. Cytochrome c is a component of the electron transport chain; the heme group transfers electrons from cytochrome b-c1 complex to cytochrome oxidase complex. Cytochrome c initiates apoptosis by release to cytoplasm and binding Apaf-1 which activates procaspase 9. Cytochrome c interacts with the cytochrome b-c1 complex, cytochrome oxidase complex, heme, Apaf-1, and Caspase 9 proteins.

Product Categories/Family for anti-CYCS antibody

Antibodies; Cytochrome

NCBI and Uniprot Product Information

• NCBI GI #: 11128019
• NCBI GeneID: 54205
• NCBI Accession #: NP_061820.1
• NCBI GenBank Nucleotide #: NM_018947
• UniProt Accession #: P99999; P00001; Q6NUR2; Q6NX69; Q96BV4; A4D166; B2R4I1
• Molecular Weight: 11,749 Da
• NCBI Official Full Name: cytochrome c
• NCBI Official Synonym Full Names: cytochrome c, somatic
• NCBI Official Symbol: CYCS
• NCBI Official Synonym Symbols: CYC; HCS; THC4
• NCBI Protein Information: cytochrome c
• UniProt Protein Name: Cytochrome c
• Protein Family: Cytochrome
• UniProt Gene Name: CYCS
• UniProt Synonym Gene Names: CYC
• UniProt Entry Name: CYC_HUMAN

NCBI Description

This gene encodes a small heme protein that functions as a central component of the electron transport chain in mitochondria. The encoded protein associates with the inner membrane of the mitochondrion where it accepts electrons from cytochrome b and transfers them to the cytochrome oxidase complex. This protein is also involved in initiation of apoptosis. Mutations in this gene are associated with autosomal dominant nonsyndromic thrombocytopenia. Numerous processed pseudogenes of this gene are found throughout the human genome.[provided by RefSeq, Jul 2010]

Uniprot Description

CYCS: Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers this electron to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain. Belongs to the cytochrome c family.

Protein type: Protein phosphatase, Ser/Thr (non-receptor); Oxidoreductase; Mitochondrial; Apoptosis

Chromosomal Location of Human Ortholog: 7p15.3

Cellular Component: protein phosphatase type 2A complex; mitochondrion; mitochondrial inner membrane; mitochondrial intermembrane space; nucleus; cytosol

Molecular Function: electron transporter, transferring electrons from CoQH2-cytochrome c reductase complex and cytochrome c oxidase complex activity; protein binding; iron ion binding; heme binding; protein serine/threonine phosphatase activity

Biological Process: mitochondrion organization and biogenesis; cellular metabolic process; response to reactive oxygen species; dephosphorylation; apoptosis; organelle organization and biogenesis; cellular respiration; mitochondrial electron transport, cytochrome c to oxygen; DNA fragmentation during apoptosis; caspase activation via cytochrome c; transmembrane transport; mitochondrial electron transport, ubiquinol to cytochrome c

Disease: Thrombocytopenia 4